BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetApoptotic peptidase activating factor 1
LigandBDBM89226
Substrate/Competitorn/a
Meas. Tech.SAR analysis of small molecule Inhibitors of Apaf-1 in a Fluorescent assay - set 2
IC50 42000±n/a nM
Citation PubChem, PC SAR analysis of small molecule Inhibitors of Apaf-1 in a Fluorescent assay - set 2 PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article,  Assay Method
 
Apoptotic peptidase activating factor 1
Name:Apoptotic peptidase activating factor 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:141834.40
Organism:Homo sapiens (Human)
Description:O14727
Residue:1248
Sequence:
MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMI
LKKDNDSYVSFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVP
QRPVVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLLEGCFPG
GVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDVWDSWVLKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVN
MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDC
MYWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAV
SENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEWINK
KNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEV
LCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHTYDEHSEQVNCCHFTNSSHHLLLATGS
SDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDATSANERKS
INVKQFFLNLEDPQEDMEVIVKCCSWSADGARIMVAAKNKIFLFDIHTSGLLGEIHTGHH
STIQYCDFSPQNHLAVVALSQYCVELWNTDSRSKVADCRGHLSWVHGVMFSPDGSSFLTS
SDDQTIRLWETKKVCKNSAVMLKQEVDVVFQENEVMVLAVDHIRRLQLINGRTGQIDYLT
EAQVSCCCLSPHLQYIAFGDENGAIEILELVNNRIFQSRFQHKKTVWHIQFTADEKTLIS
SSDDAEIQVWNWQLDKCIFLRGHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITGNKEKD
FVCHQGTVLSCDISHDATKFSSTSADKTAKIWSFDLLLPLHELRGHNGCVRCSAFSVDST
LLATGDDNGEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIK
WWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM89226
NameBDBM89226
Synonyms:1-(3,4-dichlorobenzyl)-4,6-dimethyl-isatin | 1-[(3,4-dichlorophenyl)methyl]-4,6-dimethyl-indole-2,3-dione | 1-[(3,4-dichlorophenyl)methyl]-4,6-dimethylindole-2,3-dione | MLS-0469603.0001 | cid_53389328
TypeSmall organic molecule
Emp. Form.C17H13Cl2NO2
Mol. Mass.334.197
SMILESCc1cc2N(Cc3ccc(Cl)c(Cl)c3)C(=O)C(=O)c2c(C)c1
Structure
n/a