BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetcorticotropin releasing factor-binding protein
LigandBDBM90967
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of uHTS hits for small molecule agonists of the CRF-binding protein and CRF-R2 receptor complex
EC50>53000±n/a nM
Citation PubChem, PC Dose Response confirmation of uHTS hits for small molecule agonists of the CRF-binding protein and CRF-R2 receptor complex PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article,  Assay Method
 
corticotropin releasing factor-binding protein
Name:corticotropin releasing factor-binding protein
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:36143.95
Organism:Homo sapiens (Human)
Description:P24387
Residue:322
Sequence:
MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRC
LDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKG
EKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNL
FPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGI
GDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQ
LEPYELENPNGNSIGEFCLSGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM90967
NameBDBM90967
Synonyms:3-[6-(benzylamino)-[1,2,4]triazolo[4,3-b]pyridazin-3-yl]-N-[3-(2-furyl)-1-methyl-propyl]propionamide | 3-[6-(benzylamino)-[1,2,4]triazolo[4,3-b]pyridazin-3-yl]-N-[4-(furan-2-yl)butan-2-yl]propanamide | MLS001095878 | N-[4-(2-furanyl)butan-2-yl]-3-[6-[(phenylmethyl)amino]-[1,2,4]triazolo[4,3-b]pyridazin-3-yl]propanamide | N-[4-(furan-2-yl)butan-2-yl]-3-[6-[(phenylmethyl)amino]-[1,2,4]triazolo[4,3-b]pyridazin-3-yl]propanamide | SMR000631377 | cid_20956960
TypeSmall organic molecule
Emp. Form.C23H26N6O2
Mol. Mass.418.4915
SMILESCC(CCc1ccco1)NC(=O)CCc1nnc2ccc(NCc3ccccc3)nn12
Structure
n/a