BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetperilipin-5
LigandBDBM50091987
Substrate/Competitorn/a
IC50 12417±n/a nM
Citation PubChem, PC Luminescence-based biochemical high throughput dose response assay for inhibitors of the interaction of the lipase co-activator protein, abhydrolase domain containing 5 (ABHD5) with perilipin-5 (MLDP; PLIN5) produced in HEK293T cells PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article
 
perilipin-5
Name:perilipin-5
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:50774.20
Organism:Homo sapiens (Human)
Description:gi_116292172
Residue:463
Sequence:
MSEEEAAQIPRSSVWEQDQQNVVQRVVALPLVRATCTAVCDVYSAAKDRHPLLGSACRLA
ENCVCGLTTRALDHAQPLLEHLQPQLATMNSLACRGLDKLEEKLPFLQQPSETVVTSAKD
VVASSVTGVVDLARRGRRWSVELKRSVSHAVDVVLEKSEELVDHFLPMTEEELAALAAEA
EGPEVGSVEDQRRQQGYFVRLGSLSARIRHLAYEHSVGKLRQSKHRAQDTLAQLQETLEL
IDHMQCGVTPTAPACPGKVHELWGEWGQRPPESRRRSQAELETLVLSRSLTQELQGTVEA
LESSVRGLPAGAQEKVAEVRRSVDALQTAFADARCFRDVPAAALAEGRGRVAHAHACVDE
LLELVVQAVPLPWLVGPFAPILVERPEPLPDLADLVDEVIGGPDPRWAHLDWPAQQRAWE
AEHRDGSGNGDGDRMGVAGDICEQEPETPSCPVKHTLMPELDF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50091987
NameBDBM50091987
Synonyms:3-Hydroxy-naphthalene-2-carboxylic acid (4-methoxy-phenyl)-amide | CHEMBL63883 | cid_66721
TypeSmall organic molecule
Emp. Form.C18H15NO3
Mol. Mass.293.3166
SMILESCOc1ccc(NC(=O)c2cc3ccccc3cc2O)cc1
Structure
n/a