Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldose reductase (AR)
LigandBDBM104020
Substrate/Competitorn/a
Meas. Tech.IC50 Activity Assays
pH7±n/a
Temperature298.15±n/a K
IC50 7.1e+2± 7e+1 nM
Citation Fanfrlík, JFanfrlík, MKolár, MHurný, DHurný, FXCousido-Siah, AMitschler, ARezác, JRezác, ELep?ík, MLepšík, PMatejícek, JVeselý, AHobza, P Modulation of aldose reductase inhibition by halogen bond tuning. ACS Chem Biol8:2484-92 (2013) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Aldose reductase (AR)
Name:Aldose reductase
Synonyms:AR | Aldo-keto reductase family 1 member B1 (AKR1B1) | Aldose Reductase (ALR2) | Aldose reductase
Type:Protein
Mol. Mass.:35855.50
Organism:Homo sapiens (Human)
Description:P15121. 4LAU; 2IKI; 4LB4; 2FZD; 2FZ8; 1US0
Residue:316
Sequence:
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQ
EKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGK
EFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKP
AVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAK
HNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA
LLSCTSHKDYPFHEEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM104020
NameBDBM104020
Synonyms:MK181
TypeSmall organic molecule
Emp. Form.C16H13BrClNO4
Mol. Mass.398.636
SMILESOC(=O)COc1cc(Cl)ccc1C(=O)NCc1ccc(Br)cc1
Structure
n/a