Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuraminidase A
LigandBDBM4934
Substrate/CompetitorBDBM4702
Meas. Tech.Neuraminidase Inhibition Assay
pH6.5±n/a
Temperature310.15±n/a K
IC50 5±n/a nM
Citation Smith, PWSollis, SLHowes, PDCherry, PCStarkey, IDCobley, KNWeston, HScicinski, JMerritt, AWhittington, AWyatt, PTaylor, NGreen, DBethell, RMadar, SFenton, RJMorley, PJPateman, TBeresford, A Dihydropyrancarboxamides related to zanamivir: a new series of inhibitors of influenza virus sialidases. 1. Discovery, synthesis, biological activity, and structure-activity relationships of 4-guanidino- and 4-amino-4H-pyran-6-carboxamides. J Med Chem41:787-97 (1998) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Neuraminidase A
Name:Neuraminidase A
Synonyms:Influenza A Virus Neuraminidase
Type:Enzyme
Mol. Mass.:52000.86
Organism:Influenza A virus (A/Singapore/1/57(H2N2))
Description:Q6XUE4
Residue:469
Sequence:
MNPNQKIITIGSVSLTIATVCFLMQIAILATTVTLHFKQHECDSPASNQVMPCEPIIIER
NITEIVYLNNTTIEKEICPEVVEYRNWSKPQCQITGFAPFSKDNSIRLSAGGDIWVTREP
YVSCDPGKCYQFALGQGTTLDNKHSNGTIHDRIPHRTLLMNELGVPFHLGTKQVCVAWSS
SSCHDGKAWLHVCVTGDDRNATASFIYDGRLVDSIGSWSQNILRTQESECVCINGTCTVV
MTDGSASGRADTRILFIKEGKIVHISPLSGSAQHIEECSCYPRYPDVRCICRDNWKGSNR
PVIDINMEDYSIDSSYVCSGLVGDTPRNDDSSSNSNCRDPNNERGNPGVKGWAFDNGDDV
WMGRTINKDSRSGYETFKVIGGWSTPNSKSQVNRQVIVDNNNWSGYSGIFSVEGKSCINR
CFYVELIRGRPQETRVWWTSNSIVVFCGTSGTYGTGSWPDGANINFMPI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM4934
NameBDBM4934
Synonyms:(2R,3R,4S)-4-carbamimidamido-3-acetamido-2-[(1R,2R)-1,2,3-trihydroxypropyl]-3,4-dihydro-2H-pyran-6-carboxylic acid | GG167 | Zanamivir
TypeSmall organic molecule
Emp. Form.C12H20N4O7
Mol. Mass.332.3098
SMILES[H][C@]1([#8]-[#6](=[#6]-[#6@H](\[#7]=[#6](/[#7])-[#7])-[#6@H]1-[#7]-[#6](-[#6])=O)-[#6](-[#8])=O)[#6@H](-[#8])-[#6@H](-[#8])-[#6]-[#8] |r,c:3|
Structure
BDBM4702
NameBDBM4702
Synonyms:(2R,4S,5R,6R)-5-acetamido-4-hydroxy-2-[(4-methyl-2-oxo-2H-chromen-7-yl)oxy]-6-[(1R,2R)-1,2,3-trihydroxypropyl]oxane-2-carboxylic acid | 2 -(4-methylumbelliferyl)-alpha-D-acetylneuraminic acid | neuraminidase substrate
TypeSmall organic molecule
Emp. Form.C21H25NO11
Mol. Mass.467.4233
SMILESCC(=O)N[C@@H]1[C@@H](O)C[C@](Oc2ccc3c(C)cc(=O)oc3c2)(O[C@H]1[C@H](O)[C@H](O)CO)C(O)=O |r|
Structure