Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA gyrase subunit B (DNA gyraseB)
LigandBDBM282
Substrate/Competitorn/a
Meas. Tech.GyraseB Assay
pH7.5±n/a
IC50 125± 2.4e+2 nM
Commentsextracted
Citation Janupally, RMedepi, BBrindha Devi, PSuryadevara, PJeankumar, VUKulkarni, PYogeeswari, PSriram, D Design and Biological Evaluation of Furan/Pyrrole/Thiophene-2-carboxamide Derivatives as Efficient DNA GyraseB Inhibitors of Staphylococcus aureus. Chem Biol Drug Des86:918-25 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DNA gyrase subunit B (DNA gyraseB)
Name:DNA gyrase subunit B (DNA gyraseB)
Synonyms:n/a
Type:Protein
Mol. Mass.:72516.88
Organism:Staphylococcus aureus (Firmicutes)
Description:n/a
Residue:644
Sequence:
MVTALSDVNNTDNYGAGQIQVLEGLEAVRKRPGMYIGSTSERGLHHLVWEIVDNSIDEAL
AGYANQIEVVIEKDNWIKVTDNGRGIPVDIQEKMGRPAVEVILTVLHAGGKFGGGGYKVS
GGLHGVGSSVVNALSQDLEVYVHRNETIYHQAYKKGVPQFDLKEVGTTDKTGTVIRFKAD
GDIFTETTVYNYETLQQRIRELAFLNKGIQITLRDERDEENVREDSYHYEGGIKSYVELL
NENKEPIHDEPIYIHQSKDDIEVEIAIQYNSGYATNLLTYANNIHTYEGGTHEDGFKRAL
TRVLNSYGLSSKIMKEEKDRLSGEDTREGMTAIISIKHGDPQFEGQTKTKLGNSEVRQVV
DKLFSEHFERFLYENPQVARTVVEKGIMAARARVAAKKAREVTRRKSALDVASLPGKLAD
CSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQ
MITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIA
QPPLYKLTQGKQKYYVYNDRELDKLKSELNPTPKWSIARYKGLGEMNADQLWETTMNPEH
RALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYANLDF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM282
NameBDBM282
Synonyms:(3R,4S,5R,6R)-5-hydroxy-6-[(2-hydroxy-3-{[4-hydroxy-3-(3-methylbut-2-en-1-yl)benzene]amido}-8-methyl-4-oxo-4H-chromen-7-yl)oxy]-3-methoxy-2,2-dimethyloxan-4-yl carbamate | Coumarin-Based, DNA Gyrase Inhibitor | Novobiocin
TypeAntibiotic
Emp. Form.C31H36N2O11
Mol. Mass.612.6243
SMILES[#6]-[#8]-[#6@@H]1-[#6@@H](-[#8]-[#6](-[#7])=O)-[#6@@H](-[#8])-[#6@H](-[#8]-c2ccc3c(-[#8])c(-[#7]-[#6](=O)-c4ccc(-[#8])c(-[#6]\[#6]=[#6](\[#6])-[#6])c4)c(=O)oc3c2-[#6])-[#8]C1([#6])[#6] |r|
Structure
n/a