Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLipoamide Dehydrogenase (Lpd)
LigandBDBM188294
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH7±n/a
IC50 2160±260 nM
Commentsextracted
Citation Wong, CWu, Y Compounds and methods for treating tuberculosis infection US Patent US9073941 Publication Date 7/7/2015
More Info.:Get all data from this article,  Assay Method
 
Lipoamide Dehydrogenase (Lpd)
Name:Lipoamide Dehydrogenase (Lpd)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:49231.98
Organism:Mycobacterium tuberculosis
Description:P9WHH9
Residue:464
Sequence:
MTHYDVVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVGCIPSKALLRNAELVH
IFTKDAKAFGISGEVTFDYGIAYDRSRKVAEGRVAGVHFLMKKNKITEIHGYGTFADANT
LLVDLNDGGTESVTFDNAIIATGSSTRLVPGTSLSANVVTYEEQILSRELPKSIIIAGAG
AIGMEFGYVLKNYGVDVTIVEFLPRALPNEDADVSKEIEKQFKKLGVTILTATKVESIAD
GGSQVTVTVTKDGVAQELKAEKVLQAIGFAPNVEGYGLDKAGVALTDRKAIGVDDYMRTN
VGHIYAIGDVNGLLQLAHVAEAQGVVAAETIAGAETLTLGDHRMLPRATFCQPNVASFGL
TEQQARNEGYDVVVAKFPFTANAKAHGVGDPSGFVKLVADAKHGELLGGHLVGHDVAELL
PELTLAQRWDLTASELARNVHTHPTMSEALQECFHGLVGHMINF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM188294
NameBDBM188294
Synonyms:US9073941, 622
TypeSmall organic molecule
Emp. Form.C14H11N5O2
Mol. Mass.281.2694
SMILESCn1c(=O)nc2[nH]nc(\C=C\c3ccccc3)nc2c1=O
Structure
n/a