Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldo-keto reductase family member 1B10 (AKR1B10)
LigandBDBM104020
Substrate/Competitorn/a
Meas. Tech.IC50-Activity Assay (AKR1B10)
pH7±n/a
IC50 3.7e+3± 8e+2 nM
Commentsextracted
Citation Cousido-Siah, ARuiz, FXFranflík, JGiménez-Dejoz, JMitschler, AKamlar, MVesely´, JAjani, HParés, XFarrés, JHobza, PPodjarny, AD IDD388 Polyhalogenated Derivatives as Probes for an Improved Structure-Based Selectivity of AKR1B10 Inhibitors ACS Chem Biol11:2693-2705 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldo-keto reductase family member 1B10 (AKR1B10)
Name:Aldo-keto reductase family member 1B10 (AKR1B10)
Synonyms:ARL-1 | ARP | Aldo-keto reductase family 1 member B10 | Aldo-keto reductase family 1 member B10 (AKR1B10) | Aldose reductase-like | Aldose reductase-related protein | SI reductase | Small intestine reductase | hARP
Type:Protein
Mol. Mass.:36024.67
Organism:Homo sapiens (Human)
Description:O60218. 1ZUA; 4JII; 4GQ0
Residue:316
Sequence:
MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQ
EKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGD
DLFPKDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKP
VTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAK
HKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATILSFNRNWRACN
VLQSSHLEDYPFNAEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM104020
NameBDBM104020
Synonyms:MK181
TypeSmall organic molecule
Emp. Form.C16H13BrClNO4
Mol. Mass.398.636
SMILESOC(=O)COc1cc(Cl)ccc1C(=O)NCc1ccc(Br)cc1
Structure
n/a