Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEphrin type-A receptor 2 (EPHA2)
LigandBDBM209861
Substrate/Competitorn/a
Meas. Tech.Kinobeads Competition Assay
Kd 198±0.0 nM
Citation Heinzlmeir, SKudlinzki, DSreeramulu, SKlaeger, SGande, SLLinhard, VWilhelm, MQiao, HHelm, DRuprecht, BSaxena, KMédard, GSchwalbe, HKuster, B Chemical Proteomics and Structural Biology Define EPHA2 Inhibition by Clinical Kinase Drugs. ACS Chem Biol11:3400-3411 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ephrin type-A receptor 2 (EPHA2)
Name:Ephrin type-A receptor 2 (EPHA2)
Synonyms:n/a
Type:Protein
Mol. Mass.:34367.96
Organism:Homo sapiens (Human)
Description:EPHA2 truncation (596-900 aa); 519U
Residue:305
Sequence:
DPNQAVLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEK
QRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQ
LVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTS
GGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFR
LPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRL
PSTSG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM209861
NameBDBM209861
Synonyms:5-(3-ethylsulfonylphenyl)-3,8-dimethyl-N-(1-methylpiperidin-4-yl)-9H-pyrido[2,3-b]indole-7-carboxamide | TAK-901
TypeSmall organic molecule
Emp. Form.C28H32N4O3S
Mol. Mass.504.644
SMILESCCS(=O)(=O)c1cccc(c1)-c1cc(C(=O)NC2CCN(C)CC2)c(C)c2[nH]c3ncc(C)cc3c12
Structure
n/a