Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine deaminase 3 (SanADA3)
LigandBDBM223291
Substrate/CompetitorArabinofuranosyladenine (Ara-A)
Meas. Tech.In Vitro ADA Activity Assay
pH7.2±n/a
Temperature303.15±n/a K
Ki 1± 0.1 nM
Commentsextracted
Citation Wu, PWan, DXu, GWang, GMa, HWang, TGao, YQi, JChen, XZhu, JLi, YQDeng, ZChen, W An Unusual Protector-Protégé Strategy for the Biosynthesis of Purine Nucleoside Antibiotics. Cell Chem Biol24:171-181 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine deaminase 3 (SanADA3)
Name:Adenosine deaminase 3 (SanADA3)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:38157.60
Organism:Streptomyces antibioticus
Description:GenBank: KT591401.1
Residue:356
Sequence:
MTASRIDTETLRRLPKAVLHDHLDGGLRPATVVELAAAVGHTLPTTDPDELAAWYVEAAN
SGDLVRYIATFEHTLAVMQTREGLLRTAEEYVLDLAADGVVYAEVRYAPELMLKGGLTLT
EVVEAVQEGLAAGMAKAAAAGTPVRVGTLLCGMRMFDRVREAAGLAVAYRDAGVVGFDIA
GAEDGFPPADHLDAFAYLRAESMPFTIHAGEAYGLPSIHQALQVCGAQRIGHGVRLTEDI
VDGKLGRLASWVRDRRIALEMCPTSNLQTGCATSIAEHPITALKDLGFRVTLNTDNRLVS
GTTMTREMSLLVEQAGWTVEDLRTVTVNALKSAFVPFDERTALIEDVVLPGYAAAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM223291
NameBDBM223291
Synonyms:Pentostatin (PTN)
TypeSmall organic molecule
Emp. Form.C11H16N4O4
Mol. Mass.268.2691
SMILESOC[C@H]1O[C@H](C[C@@H]1O)n1cnc2[C@H](O)CN=CNc12 |c:16|
Structure
Arabinofuranosyladenine (Ara-A)
NameBDBM50144936
Synonyms:CHEMBL1090 | VIDARABINE | adenine arabinoside
TypeSmall organic molecule
Emp. Form.C10H13N5O4
Mol. Mass.267.2413
SMILESNc1ncnc2n(cnc12)[C@@H]1O[C@H](CO)[C@@H](O)[C@@H]1O |r|
Structure