Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 1
LigandBDBM91988
Substrate/Competitorn/a
Meas. Tech.Photometric_Method2
Ki 120.2±n/a nM
Citation D3R, DD Vertex ERK2 D3R D3R Publication Date 6/30/2015
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 1
Name:Mitogen-activated protein kinase 1
Synonyms:ERK2 | ERT1 | Extracellular signal-regulated kinase 2 | Extracellular signal-regulated kinase 2 (ERK-2) | Extracellular signal-regulated kinase 2 (ERK2) | MAP Kinase 2/ERK2 | MAPK 2 | MAPK1 | Mitogen activated kinase 1 (ERK-2) | Mitogen-activated protein kinase 1 (ERK-2) | Mitogen-activated protein kinase 1 (ERK2) | Mitogen-activated protein kinase 2 | p42-MAPK
Type:Ser/Thr Protein Kinase
Mol. Mass.:41392.76
Organism:Homo sapiens (Human)
Description:P28482
Residue:360
Sequence:
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM91988
NameBDBM91988
Synonyms:erk000060
Typen/a
Emp. Form.C21H25N5O2
Mol. Mass.379.4555
SMILESCCNc1ncc(CC)c(n1)-c1c[nH]c(c1)C(=O)N[C@H](CO)c1ccccc1
Structure
n/a