Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 2A
LigandBDBM463329
Substrate/Competitorn/a
Meas. Tech.[125I]DOI Radioligand Binding Assay
IC50 10.2±n/a nM
Citation Teegarden, BXiong, YStrah-Pleynet, SJayakumar, HDosa, PIFeichtinger, KCasper, MLehmann, JJones, RMUnett, DJChoi, JS 3-phenyl-pyrazole derivatives as modulators of the 5-HT2A serotonin receptor useful for the treatment of disorders related thereto US Patent US10781180 Publication Date 9/22/2020
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 2A
Name:5-hydroxytryptamine receptor 2A
Synonyms:5-HT-2 | 5-HT-2A | 5-HT2A | 5-hydroxytryptamine receptor 2A (5-HT-2A) | 5-hydroxytryptamine receptor 2A (5HT-2A) | 5-hydroxytryptamine receptor 2A (5HT2A) | HTR2 | HTR2A | Serotonin receptor 2A
Type:undefined
Mol. Mass.:52607.65
Organism:Homo sapiens (Human)
Description:P28223
Residue:471
Sequence:
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM463329
NameBDBM463329
Synonyms:1-(4-Chloro-benzyl)-3-[3-(2-methyl-2H-pyrazol-3-yl)-4-(2-piperidin-1-yl-ethoxy)-phenyl]-urea | US10781180, Compound 45
TypeSmall organic molecule
Emp. Form.C24H28ClN5O2
Mol. Mass.453.964
SMILESCn1nccc1-c1cc(NC(=O)NCc2ccc(Cl)cc2)ccc1OCCN1CCCC1
Structure
n/a