Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAmine oxidase, copper containing
LigandBDBM385387
Substrate/Competitorn/a
Meas. Tech.In Vitro Activity Assay
IC50 12.0±1 nM
Citation Coates, DAQin, LHWei, YZhou, J Amino pyrimidine ssao inhibitors US Patent US10793552 Publication Date 10/6/2020
More Info.:Get all data from this article,  Assay Method
 
Amine oxidase, copper containing
Name:Amine oxidase, copper containing
Synonyms:Semicarbazide-sensitive amine oxidase (SSAO) | Semicarbazide-sensitive amine oxidase/ Vascular adhesion protein 1 (SSAO/VAP-1)
Type:Protein
Mol. Mass.:84620.86
Organism:Homo sapiens (Human)
Description:Q16853
Residue:763
Sequence:
MNQKTILVLLILAVITIFALVCVLLVGRGGDGGEPSQLPHCPSVSPSAQPWTHPGQSQLF
ADLSREELTAVMRFLTQRLGPGLVDAAQARPSDNCVFSVELQLPPKAAALAHLDRGSPPP
AREALAIVFFGRQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLFQEYLDID
QMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFL
HHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLIPDNGTGGSW
SLKSPVPPGPAPPLQFYPQGPRFSVQGSRVASSLWTFSFGLGAFSGPRIFDVRFQGERLV
YEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQ
APKTIRDAFCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLNYDYVWDTVFH
PSGAIEIRFYATGYISSAFLFGATGKYGNQVSEHTLGTVHTHSAHFKVDLDVAGLENWVW
AEDMVFVPMAVPWSPEHQLQRLQVTRKLLEMEEQAAFLVGSATPRYLYLASNHSNKWGHP
RGYRIQMLSFAGEPLPQNSSMARGFSWERYQLAVTQRKEEEPSSSSVFNQNDPWAPTVDF
SDFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSA
DSIYFRGDQDAGACEVNPLACLPQAAACAPDLPAFSHGGFSHN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM385387
NameBDBM385387
Synonyms:(E)-3-Fluoro-2-[[2-(4-methoxy-1-piperidyl)pyrimidin-5-yl]oxymethyl]prop-2-en-1-amine, Dihydrochloride | US10287270, Example 3 | US10464928, Example 3 | US10793552, Example 3
TypeSmall organic molecule
Emp. Form.C14H21FN4O2
Mol. Mass.296.3405
SMILESCOC1CCN(CC1)c1ncc(OC\C(CN)=C\F)cn1
Structure
n/a