Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKynurenine/alpha-aminoadipate aminotransferase, mitochondrial
LigandBDBM466252
Substrate/Competitorn/a
Meas. Tech.Inhibitory Assay
IC50 12.0±n/a nM
Citation Okuyama, MFukunaga, KUsui, KHayashi, NIijima, DHoriuchi, HFujimoto, N Bicyclic heterocyclic compound US Patent US10793582 Publication Date 10/6/2020
More Info.:Get all data from this article,  Assay Method
 
Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
Name:Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial
Synonyms:2-aminoadipate aminotransferase | 2-aminoadipate transaminase | AADAT | Alpha-aminoadipate aminotransferase | KAT/AadAT | KAT2 | Kynurenine aminotransferase II | Kynurenine aminotransferase II (KAT II) | Kynurenine--oxoglutarate aminotransferase II | Kynurenine--oxoglutarate transaminase 2 | Kynurenine--oxoglutarate transaminase II
Type:Enzyme
Mol. Mass.:47353.09
Organism:Homo sapiens (Human)
Description:Q8N5Z0
Residue:425
Sequence:
MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKT
IQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQG
LCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKP
EDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNK
FRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQ
LMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKV
KGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL
IKESL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM466252
NameBDBM466252
Synonyms:US10793582, Example 66
TypeSmall organic molecule
Emp. Form.C23H21N5O2S
Mol. Mass.431.51
SMILESO=C(NCc1ccccc1)[C@H]1CCCN1c1nc2ncnc(Oc3ccccc3)c2s1 |r|
Structure
n/a