Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDipeptidyl peptidase IV
LigandBDBM50003020
Substrate/Competitorn/a
Meas. Tech.Inhibition Enzyme Activity Assay
IC50 4.20±n/a nM
Citation Sang, GLiu, LZhang, AQiao, JGuo, XZhang, XXia, C Crystal of DPP-IV long-acting inhibitor and salt US Patent US10822319 Publication Date 11/3/2020
More Info.:Get all data from this article,  Assay Method
 
Dipeptidyl peptidase IV
Name:Dipeptidyl peptidase IV
Synonyms:Bile canaliculus domain-specific membrane glycoprotein | CD_antigen=CD26 | DPP IV | Dipeptidyl Peptidase IV (DPP-IV) | Dipeptidyl peptidase 4 | Dipeptidyl peptidase 4 (DDPIV) | Dipeptidyl peptidase 4 60 kDa soluble form | Dipeptidyl peptidase 4 membrane form | Dipeptidyl peptidase 4 soluble form | Dipeptidyl peptidase IV 60 kDa soluble form | Dipeptidyl peptidase IV membrane form | Dipeptidyl peptidase IV soluble form | GP110 glycoprotein | T-cell activation antigen CD26
Type:Enzyme
Mol. Mass.:88084.94
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:767
Sequence:
MKTPWKVLLGLLGVAALVTIITVPVVLLNKDEAAADSRRTYTLADYLKNTFRVKSYSLRW
VSDSEYLYKQENNILLFNAEHGNSSIFLENSTFEIFGDSISDYSVSPDRLFVLLEYNYVK
QWRHSYTASYSIYDLNKRQLITEEKIPNNTQWITWSQEGHKLAYVWKNDIYVKIEPHLPS
HRITSTGKENVIFNGINDWVYEEEIFGAYSALWWSPNGTFLAYAQFNDTGVPLIEYSFYS
DESLQYPKTVWIPYPKAGAVNPTVKFFIVNTDSLSSTTTTIPMQITAPASVTTGDHYLCD
VAWVSEDRISLQWLRRIQNYSVMAICDYDKTTLVWNCPTTQEHIETSATGWCGRFRPAEP
HFTSDGSSFYKIVSDKDGYKHICQFQKDRKPEQVCTFITKGAWEVISIEALTSDYLYYIS
NEYKEMPGGRNLYKIQLTDHTNKKCLSCDLNPERCQYYSVSLSKEAKYYQLGCRGPGLPL
YTLHRSTDQKELRVLEDNSALDKMLQDVQMPSKKLDFIVLNETRFWYQMILPPHFDKSKK
YPLLIDVYAGPCSQKADAAFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINKRLG
TLEVEDQIEAARQFLKMGFVDSKRVAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRW
EYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQI
SKALVDAGVDFQAMWYTDEDHGIASSTAHQHIYSHMSHFLQQCFSLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003020
NameBDBM50003020
Synonyms:MK-3102 | OMARIGLIPTIN | US10155775, Omarigliptin | US10479798, Compound MK3102 | US10822319, Compound Omarigliptin
TypeSmall organic molecule
Emp. Form.C17H20F2N4O3S
Mol. Mass.398.428
SMILESCS(=O)(=O)n1cc2CN(Cc2n1)[C@H]1CO[C@@H]([C@@H](N)C1)c1cc(F)ccc1F |r|
Structure
n/a