BindingDB Reactant_set_id	Ligand SMILES	Ligand InChI	Ligand InChI Key	BindingDB MonomerID	BindingDB Ligand Name	Target Name	Target Source Organism According to Curator or DataSource	Ki (nM)	IC50 (nM)	Kd (nM)	EC50 (nM)	kon (M-1-s-1)	koff (s-1)	pH	Temp (C)	Curation/DataSource	Article DOI	BindingDB Entry DOI	PMID	PubChem AID	Patent Number	Authors	Institution	Link to Ligand in BindingDB	Link to Target in BindingDB	Link to Ligand-Target Pair in BindingDB	Ligand HET ID in PDB	PDB ID(s) for Ligand-Target Complex	PubChem CID of Ligand	PubChem SID of Ligand	ChEBI ID of Ligand	ChEMBL ID of Ligand	DrugBank ID of Ligand	IUPHAR_GRAC ID of Ligand	KEGG ID of Ligand	ZINC ID of Ligand	Number of Protein Chains in Target (>1 implies a multichain complex)	BindingDB Target Chain Sequence	PDB ID(s) of Target Chain	UniProt (SwissProt) Recommended Name of Target Chain	UniProt (SwissProt) Entry Name of Target Chain	UniProt (SwissProt) Primary ID of Target Chain	UniProt (SwissProt) Secondary ID(s) of Target Chain	UniProt (SwissProt) Alternative ID(s) of Target Chain	UniProt (TrEMBL) Submitted Name of Target Chain	UniProt (TrEMBL) Entry Name of Target Chain	UniProt (TrEMBL) Primary ID of Target Chain	UniProt (TrEMBL) Secondary ID(s) of Target Chain	UniProt (TrEMBL) Alternative ID(s) of Target Chain
176856	COc1ccc2C(CC(Oc2c1)c1cccc(O)c1)n1ccnc1	InChI=1S/C19H18N2O3/c1-23-15-5-6-16-17(21-8-7-20-12-21)11-18(24-19(16)10-15)13-3-2-4-14(22)9-13/h2-10,12,17-18,22H,11H2,1H3	PKUUIOFUZHJBPC-UHFFFAOYSA-N	85249	2,4-Trans-3'-hydroxy-4-imidazolyl-7-methoxyflavan, 3a	Aromatase [1-48]	Homo sapiens		 130							Curated from the literature by BindingDB	10.1016/j.bioorg.2004.06.008	10.7270/Q21R6P2Z	15530990	aid1799648		Pouget, C; Yahiaoui, S; Fagnere, C; Habrioux, G; Chulia, AJ	Biomolécules et Cibles Cellulaires Tumorales	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=85249	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5004&target=Aromatase+%5B1-48%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=85249&enzyme=Aromatase+%5B1-48%5D&column=ki&startPg=0&Increment=50&submit=Search			57340033	136351349						ZINC87722692	1	MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIP		Aromatase	CP19A_HUMAN	P11511	Q16731 Q3B764 Q58FA0 Q8IYJ7						
176857	COc1ccc2C(CC(Oc2c1)c1ccc(Cl)cc1)n1ccnc1	InChI=1S/C19H17ClN2O2/c1-23-15-6-7-16-17(22-9-8-21-12-22)11-18(24-19(16)10-15)13-2-4-14(20)5-3-13/h2-10,12,17-18H,11H2,1H3	OJGDRCGNIWYTLG-UHFFFAOYSA-N	85250	2,4-Trans-4'-chloro-4-imidazolyl-7-methoxyflavan, 3b	Aromatase [1-48]	Homo sapiens		 200							Curated from the literature by BindingDB	10.1016/j.bioorg.2004.06.008	10.7270/Q21R6P2Z	15530990	aid1799648		Pouget, C; Yahiaoui, S; Fagnere, C; Habrioux, G; Chulia, AJ	Biomolécules et Cibles Cellulaires Tumorales	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=85250	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5004&target=Aromatase+%5B1-48%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=85250&enzyme=Aromatase+%5B1-48%5D&column=ki&startPg=0&Increment=50&submit=Search			57340034	136351350						ZINC89456165	1	MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIP		Aromatase	CP19A_HUMAN	P11511	Q16731 Q3B764 Q58FA0 Q8IYJ7						
176858	COc1ccc2C(CC(Oc2c1)c1ccc(cc1)C#N)n1ccnc1	InChI=1S/C20H17N3O2/c1-24-16-6-7-17-18(23-9-8-22-13-23)11-19(25-20(17)10-16)15-4-2-14(12-21)3-5-15/h2-10,13,18-19H,11H2,1H3	KUJNSKVJMZIYFO-UHFFFAOYSA-N	85251	2,4-Trans-4'-cyano-4-imidazolyl-7-methoxyflavan, 3c	Aromatase [1-48]	Homo sapiens		 133							Curated from the literature by BindingDB	10.1016/j.bioorg.2004.06.008	10.7270/Q21R6P2Z	15530990	aid1799648		Pouget, C; Yahiaoui, S; Fagnere, C; Habrioux, G; Chulia, AJ	Biomolécules et Cibles Cellulaires Tumorales	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=85251	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5004&target=Aromatase+%5B1-48%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=85251&enzyme=Aromatase+%5B1-48%5D&column=ki&startPg=0&Increment=50&submit=Search			54587195	136351351						ZINC71295761	1	MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIP		Aromatase	CP19A_HUMAN	P11511	Q16731 Q3B764 Q58FA0 Q8IYJ7						
176859	COc1ccc2C(CC(Oc2c1)c1ccc(O)cc1)n1ccnc1	InChI=1S/C19H18N2O3/c1-23-15-6-7-16-17(21-9-8-20-12-21)11-18(24-19(16)10-15)13-2-4-14(22)5-3-13/h2-10,12,17-18,22H,11H2,1H3	IXGZSUBGCCMHJQ-UHFFFAOYSA-N	85252	2,4-Trans-4'-hydroxy-4-imidazolyl-7-methoxyflavan, 3d	Aromatase [1-48]	Homo sapiens		 40							Curated from the literature by BindingDB	10.1016/j.bioorg.2004.06.008	10.7270/Q21R6P2Z	15530990	aid1799648		Pouget, C; Yahiaoui, S; Fagnere, C; Habrioux, G; Chulia, AJ	Biomolécules et Cibles Cellulaires Tumorales	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=85252	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5004&target=Aromatase+%5B1-48%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=85252&enzyme=Aromatase+%5B1-48%5D&column=ki&startPg=0&Increment=50&submit=Search			54580299	136351352						ZINC71294589	1	MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIP		Aromatase	CP19A_HUMAN	P11511	Q16731 Q3B764 Q58FA0 Q8IYJ7						
176860	Oc1ccc(cc1)C1CC(c2ccc(O)cc2O1)n1ccnc1	InChI=1S/C18H16N2O3/c21-13-3-1-12(2-4-13)17-10-16(20-8-7-19-11-20)15-6-5-14(22)9-18(15)23-17/h1-9,11,16-17,21-22H,10H2	PFHRDEAWLUWODW-UHFFFAOYSA-N	85253	2,4-Trans-4',7-dihydroxy-4-imidazolyl-7-methoxyflavan, 3e	Aromatase [1-48]	Homo sapiens		 77							Curated from the literature by BindingDB	10.1016/j.bioorg.2004.06.008	10.7270/Q21R6P2Z	15530990	aid1799648		Pouget, C; Yahiaoui, S; Fagnere, C; Habrioux, G; Chulia, AJ	Biomolécules et Cibles Cellulaires Tumorales	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=85253	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5004&target=Aromatase+%5B1-48%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=85253&enzyme=Aromatase+%5B1-48%5D&column=ki&startPg=0&Increment=50&submit=Search			57340035	136351353						ZINC87722702	1	MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIP		Aromatase	CP19A_HUMAN	P11511	Q16731 Q3B764 Q58FA0 Q8IYJ7						
176861	N#Cc1ccc(cc1)C(c1ccc(cc1)C#N)n1cncn1	InChI=1S/C17H11N5/c18-9-13-1-5-15(6-2-13)17(22-12-20-11-21-22)16-7-3-14(10-19)4-8-16/h1-8,11-12,17H	HPJKCIUCZWXJDR-UHFFFAOYSA-N	13061	4,4 -(1H-1,2,4-triazol-1-ylmethanediyl)dibenzonitrile::4-[(4-cyanophenyl)(1H-1,2,4-triazol-1-yl)methyl]benzonitrile::CHEMBL1444::Letrozole	Aromatase [1-48]	Homo sapiens		 18							Curated from the literature by BindingDB	10.1016/j.bioorg.2004.06.008	10.7270/Q21R6P2Z	15530990	aid1799648		Pouget, C; Yahiaoui, S; Fagnere, C; Habrioux, G; Chulia, AJ	Biomolécules et Cibles Cellulaires Tumorales	http://www.bindingdb.org/bind/chemsearch/marvin/MolStructure.jsp?monomerid=13061	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=pol&polymerid=5004&target=Aromatase+%5B1-48%5D&column=ki&startPg=0&Increment=50&submit=Search	http://www.bindingdb.org/jsp/dbsearch/PrimarySearch_ki.jsp?energyterm=kJ/mole&tag=r21&monomerid=13061&enzyme=Aromatase+%5B1-48%5D&column=ki&startPg=0&Increment=50&submit=Search			3902	46513479	6413	CHEMBL1444	DB01006	5209	C08163	ZINC03778874	1	MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIP		Aromatase	CP19A_HUMAN	P11511	Q16731 Q3B764 Q58FA0 Q8IYJ7