Compile Data Set for Download or QSAR
maximum 50k data
Found 5376 with Last Name = 'yu' and Initial = 'x'
TargetE3 ubiquitin-protein ligase Mdm2(Homo sapiens (Human))
Shanghai Institute Of Materia Medica

Curated by ChEMBL
LigandPNGBDBM50605126(CHEMBL5187340)
Affinity DataKi:  0.00200nMAssay Description:Displacement of 5-FAM labeled PDI peptide from MDM2 (1 to 118 residues) (unknown origin) expressed in Escherichia coli BL21 (DE3) assessed as inhibit...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetApoptosis regulator Bcl-2(Homo sapiens (Human))
Yancheng Teachers University

Curated by ChEMBL
LigandPNGBDBM50162774(ABT-199 | US11420968, Example ABT-199 | Venetoclax)
Affinity DataKi: <0.0100nMAssay Description:Displacement of fluorescent-labeled BID-BH3 peptide from human BCL-2 expressed in Escherichia coli BL21 (DE3) assessed as inhibition constant by fluo...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetProtease(Human immunodeficiency virus 1 (HIV-1))
Purdue University

Curated by ChEMBL
LigandPNGBDBM50498326(CHEMBL3581674)
Affinity DataKi:  0.0120nMAssay Description:Inhibition of wild type HIV1 proteaseMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetDihydrofolate reductase(Homo sapiens (Human))
Zhengzhou University

Curated by ChEMBL
LigandPNGBDBM50457437(CHEBI:71223 | Folotyn | PDX | Pralatrexate)
Affinity DataKi:  0.0130nMAssay Description:Inhibition of DHFR (unknown origin) at pH 6.7More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetProtease(Human immunodeficiency virus 1 (HIV-1))
Purdue University

Curated by ChEMBL
LigandPNGBDBM50498324(CHEMBL3581666)
Affinity DataKi:  0.0140nMAssay Description:Inhibition of wild type HIV1 proteaseMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetProtease(Human immunodeficiency virus 1 (HIV-1))
Purdue University

Curated by ChEMBL
LigandPNGBDBM50498327(CHEMBL3581664)
Affinity DataKi:  0.0140nMAssay Description:Inhibition of wild type HIV1 proteaseMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetProtease(Human immunodeficiency virus 1 (HIV-1))
Purdue University

Curated by ChEMBL
LigandPNGBDBM8125((3R,3aS,6aR)-hexahydrofuro[2,3-b]furan-3-yl N-[(2S...)
Affinity DataKi:  0.0160nMAssay Description:Inhibition of HIV1 proteaseMore data for this Ligand-Target Pair
TargetNon-receptor tyrosine-protein kinase TYK2(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50507816(Bms-986165 | Deucravacitinib)
Affinity DataKi:  0.0200nMAssay Description:Inhibition of TYK2 in human Jurkat cells assessed as reduction in IFN-alpha stimulated TYK2 phosphorylation by caspase3/7 reagent-based Western blot ...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtease(Human immunodeficiency virus 1 (HIV-1))
Purdue University

Curated by ChEMBL
LigandPNGBDBM50498328(CHEMBL3581663)
Affinity DataKi:  0.0250nMAssay Description:Inhibition of wild type HIV1 proteaseMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
Target5-hydroxytryptamine receptor 1A(Homo sapiens (Human))
Shanghai Institute Of Pharmaceutical Industry

Curated by ChEMBL
LigandPNGBDBM50607169(CHEMBL5220371)
Affinity DataKi:  0.0690nMAssay Description:Displacement of [3H]8-OH-DAPT from 5-HT1A receptor in human HEK293 cells measured after 60 mins by scintillation counting methodMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetD(3) dopamine receptor(Homo sapiens (Human))
Shanghai Institute Of Pharmaceutical Industry

Curated by ChEMBL
LigandPNGBDBM50443101(Cariprazine | RGH-188)
Affinity DataKi:  0.0850nMAssay Description:Displacement of [3H]methyl-spiperone from recombinant human D3 receptor expressed in CHO cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target5-hydroxytryptamine receptor 1A(Homo sapiens (Human))
Shanghai Institute Of Pharmaceutical Industry

Curated by ChEMBL
LigandPNGBDBM50607170(CHEMBL5220872)
Affinity DataKi:  0.0970nMAssay Description:Displacement of [3H]8-OH-DAPT from 5-HT1A receptor in human HEK293 cells measured after 60 mins by scintillation counting methodMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
Target5-hydroxytryptamine receptor 1A(Homo sapiens (Human))
Shanghai Institute Of Pharmaceutical Industry

Curated by ChEMBL
LigandPNGBDBM50529312(CHEMBL4444213)
Affinity DataKi:  0.200nMAssay Description:Displacement of [3H]8-OH-DAPT from 5-HT1A receptor in human HEK293 cells measured after 60 mins by scintillation counting methodMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetProtease(Human immunodeficiency virus 1 (HIV-1))
Purdue University

Curated by ChEMBL
LigandPNGBDBM31817(GRL-02031 | methyl-2-pyrrolidinone, 19b)
Affinity DataKi:  0.440nMAssay Description:Inhibition of HIV1 wild type protease using Abz-Thr-Ile-Nle-p-nitro-Phe-Gln-Arg-NH2 as substrate after 5 mins by spectrophotometryMore data for this Ligand-Target Pair
TargetProtease(Human immunodeficiency virus 1 (HIV-1))
Purdue University

Curated by ChEMBL
LigandPNGBDBM50498325(CHEMBL3581665)
Affinity DataKi:  0.450nMAssay Description:Inhibition of wild type HIV1 proteaseMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetHIV-1 protease(Human immunodeficiency virus)
Georgia State University

Curated by ChEMBL
LigandPNGBDBM31817(GRL-02031 | methyl-2-pyrrolidinone, 19b)
Affinity DataKi:  0.460nMAssay Description:Inhibition of HIV1 protease I47V mutant using Abz-Thr-Ile-Nle-p-nitro-Phe-Gln-Arg-NH2 as substrate after 5 mins by spectrophotometryMore data for this Ligand-Target Pair
TargetD(2) dopamine receptor(Homo sapiens (Human))
Shanghai Institute Of Pharmaceutical Industry

Curated by ChEMBL
LigandPNGBDBM50443101(Cariprazine | RGH-188)
Affinity DataKi:  0.490nMAssay Description:Displacement of [3H]-spiperone from recombinant human D2L receptor expressed in CHO cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMedDrugBank

TargetE3 ubiquitin-protein ligase Mdm2(Homo sapiens (Human))
Shanghai Institute Of Materia Medica

Curated by ChEMBL
LigandPNGBDBM50605132(CHEMBL5171665)
Affinity DataKi:  0.5nMAssay Description:Displacement of 5-FAM labeled PDI peptide from MDM2 (1 to 118 residues) (unknown origin) expressed in Escherichia coli BL21 (DE3) assessed as inhibit...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetD(3) dopamine receptor(Homo sapiens (Human))
Shanghai Institute Of Pharmaceutical Industry

Curated by ChEMBL
LigandPNGBDBM50549018(CHEMBL4799863)
Affinity DataKi:  0.5nMAssay Description:Displacement of [3H]methyl-spiperone from recombinant human D3 receptor expressed in CHO cellsMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCannabinoid receptor 2(Homo sapiens (Human))
Astrazeneca R&D Montreal

Curated by ChEMBL
LigandPNGBDBM50364921(CHEMBL1950329)
Affinity DataKi:  0.560nMAssay Description:Binding affinity to human CB2 receptorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtease(Human immunodeficiency virus 1 (HIV-1))
Purdue University

Curated by ChEMBL
LigandPNGBDBM50498331(CHEMBL3581669)
Affinity DataKi:  0.580nMAssay Description:Inhibition of wild type HIV1 proteaseMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361648(CHEMBL1940246)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361649(CHEMBL1938415)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
TargetProtease(Human immunodeficiency virus 1 (HIV-1))
Purdue University

Curated by ChEMBL
LigandPNGBDBM50498320(CHEMBL3581667)
Affinity DataKi:  0.630nMAssay Description:Inhibition of wild type HIV1 proteaseMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetHIV-1 protease(Human immunodeficiency virus)
Georgia State University

Curated by ChEMBL
LigandPNGBDBM31817(GRL-02031 | methyl-2-pyrrolidinone, 19b)
Affinity DataKi:  0.650nMAssay Description:Inhibition of HIV1 protease V82A mutant using Abz-Thr-Ile-Nle-p-nitro-Phe-Gln-Arg-NH2 as substrate after 5 mins by spectrophotometryMore data for this Ligand-Target Pair
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)
Affinity DataKi:  0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHistone-lysine N-methyltransferase EZH2(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50193709(CHEMBL3911017)
Affinity DataKi:  0.700nMAssay Description:Inhibition of wild-type EZH2 (unknown origin) expressed in baculovirus infected SF9 cells co-expressing SUZ12/EED/RbAp48 complex using HeLa cells der...More data for this Ligand-Target Pair
TargetAlpha-1A/Alpha-1B/Alpha-1D adrenergic receptor(Homo sapiens (Human))
Shanghai Institute Of Pharmaceutical Industry

Curated by ChEMBL
LigandPNGBDBM50001885((risperidone)3-{2-[4-(6-Fluoro-benzo[d]isoxazol-3-...)
Affinity DataKi:  0.700nMAssay Description:Binding affinity to adrenergic alpha1 receptor (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMedDrugBank

TargetHIV-1 protease(Human immunodeficiency virus)
Georgia State University

Curated by ChEMBL
LigandPNGBDBM31817(GRL-02031 | methyl-2-pyrrolidinone, 19b)
Affinity DataKi:  0.800nMAssay Description:Inhibition of HIV1 protease L76V mutant using Abz-Thr-Ile-Nle-p-nitro-Phe-Gln-Arg-NH2 as substrate after 5 mins by spectrophotometryMore data for this Ligand-Target Pair
TargetE3 ubiquitin-protein ligase Mdm2(Homo sapiens (Human))
Shanghai Institute Of Materia Medica

Curated by ChEMBL
LigandPNGBDBM50605125(CHEMBL5197279)
Affinity DataKi:  0.800nMAssay Description:Displacement of 5-FAM labeled PDI peptide from MDM2 (1 to 118 residues) (unknown origin) expressed in Escherichia coli BL21 (DE3) assessed as inhibit...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetProtease(Human immunodeficiency virus 1 (HIV-1))
Purdue University

Curated by ChEMBL
LigandPNGBDBM50498330(CHEMBL3581673)
Affinity DataKi:  0.820nMAssay Description:Inhibition of wild type HIV1 proteaseMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sidPDB
TargetVesicular acetylcholine transporter(Homo sapiens (Human))
Washington University

Curated by ChEMBL
LigandPNGBDBM50108979(CHEMBL3597316)
Affinity DataKi:  0.870nMAssay Description:Displacement of [3H]-vesamicol from human VAChT after 24 hrs by by liquid scintillation spectrometry analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361641(CHEMBL1940247)
Affinity DataKi:  0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHIV-1 protease(Human immunodeficiency virus)
Georgia State University

Curated by ChEMBL
LigandPNGBDBM31817(GRL-02031 | methyl-2-pyrrolidinone, 19b)
Affinity DataKi:  0.920nMAssay Description:Inhibition of HIV1 protease N88D mutant using Abz-Thr-Ile-Nle-p-nitro-Phe-Gln-Arg-NH2 as substrate after 5 mins by spectrophotometryMore data for this Ligand-Target Pair
TargetHistamine H1 receptor(Homo sapiens (Human))
Shanghai Institute Of Pharmaceutical Industry

Curated by ChEMBL
LigandPNGBDBM50549038(CHEBI:71257 | CHEMBL504548)
Affinity DataKi:  1nMAssay Description:Binding affinity to H1 histamine receptor (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361652(CHEMBL1940250)
Affinity DataKi:  1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetE3 ubiquitin-protein ligase Mdm2(Homo sapiens (Human))
Shanghai Institute Of Materia Medica

Curated by ChEMBL
LigandPNGBDBM50605123(CHEMBL5181559)
Affinity DataKi:  1.10nMAssay Description:Displacement of 5-FAM labeled PDI peptide from MDM2 (1 to 118 residues) (unknown origin) expressed in Escherichia coli BL21 (DE3) assessed as inhibit...More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetCathepsin K(Homo sapiens (Human))
Jilin University

Curated by ChEMBL
LigandPNGBDBM50517806(CHEMBL4541720)
Affinity DataKi:  1.10nMAssay Description:Inhibition of recombinant His-tagged human cathepsin K expressed in Escherichia coliMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetD(3) dopamine receptor(Homo sapiens (Human))
Shanghai Institute Of Pharmaceutical Industry

Curated by ChEMBL
LigandPNGBDBM50549021(CHEMBL4797996)
Affinity DataKi:  1.10nMAssay Description:Displacement of [3H]methyl-spiperone from recombinant human D3 receptor expressed in CHO cellsMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetD(3) dopamine receptor(Homo sapiens (Human))
Shanghai Institute Of Pharmaceutical Industry

Curated by ChEMBL
LigandPNGBDBM50549019(CHEMBL4753808)
Affinity DataKi:  1.20nMAssay Description:Displacement of [3H]methyl-spiperone from recombinant human D3 receptor expressed in CHO cellsMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetVesicular acetylcholine transporter(Homo sapiens (Human))
Washington University

Curated by ChEMBL
LigandPNGBDBM50108980(CHEMBL3597317)
Affinity DataKi:  1.20nMAssay Description:Displacement of [3H]-vesamicol from human VAChT after 24 hrs by by liquid scintillation spectrometry analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAlpha-1A/Alpha-1B/Alpha-1D adrenergic receptor(Homo sapiens (Human))
Shanghai Institute Of Pharmaceutical Industry

Curated by ChEMBL
LigandPNGBDBM50549038(CHEBI:71257 | CHEMBL504548)
Affinity DataKi:  1.20nMAssay Description:Binding affinity to adrenergic alpha1 receptor (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetThymidylate synthase(Homo sapiens (Human))
Zhengzhou University

Curated by ChEMBL
LigandPNGBDBM50027656(CHEBI:63616 | LY-2315 | LY-231514 | PEMETREXED | U...)
Affinity DataKi:  1.30nMAssay Description:Inhibition of thymidylate synthase (unknown origin) assessed as inhibition constantMore data for this Ligand-Target Pair
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361650(CHEMBL1940248)
Affinity DataKi:  1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetE3 ubiquitin-protein ligase Mdm2(Homo sapiens (Human))
Shanghai Institute Of Materia Medica

Curated by ChEMBL
LigandPNGBDBM50605114(CHEMBL5173513)
Affinity DataKi:  1.30nMAssay Description:Displacement of 5-FAM labeled PDI peptide from MDM2 (1 to 118 residues) (unknown origin) expressed in Escherichia coli BL21 (DE3) assessed as inhibit...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
TargetE3 ubiquitin-protein ligase Mdm2(Homo sapiens (Human))
Shanghai Institute Of Materia Medica

Curated by ChEMBL
LigandPNGBDBM50605147(CHEMBL5169689)
Affinity DataKi:  1.40nMAssay Description:Displacement of 5-FAM labeled PDI peptide from MDM2 (1 to 118 residues) (unknown origin) expressed in Escherichia coli BL21 (DE3) assessed as inhibit...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361643(CHEMBL1940252)
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361644(CHEMBL1940253)
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProtease(Human immunodeficiency virus 1 (HIV-1))
Purdue University

Curated by ChEMBL
LigandPNGBDBM50498323(CHEMBL3581668)
Affinity DataKi:  1.5nMAssay Description:Inhibition of wild type HIV1 proteaseMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
Target5-hydroxytryptamine receptor 1A(Homo sapiens (Human))
Shanghai Institute Of Pharmaceutical Industry

Curated by ChEMBL
LigandPNGBDBM50472100(CHEMBL147922)
Affinity DataKi:  1.5nMAssay Description:Displacement of [3H]8-OH-DAPT from 5-HT1A receptor in human HEK293 cells measured after 60 mins by scintillation counting methodMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails PubMed
Displayed 1 to 50 (of 5376 total ) | Next | Last >>
Jump to: