Cell Reactant:
F9.13.7 Fab
Syringe Reactant:
Lysozyme (hen egg)
Meas. Tech.:
ITC
Entry Date.:
12/11/00
ΔG°:
-41.8±1.3 (kJ/mole)
pH:
7.1±n/a
Log10Kb:
7.5
Temperature:
321.25±0.1 (K)
ΔH° :
-108±n/a (kJ/mole)
ΔHobs :
-108±n/a (kJ/mole)
ΔCp :
-2.72±0.16 (kJ/mole)
ΔS° :
-0.205±0.012 (kJ/mole-K)
Citation
 Schwarz, FPTello, DGoldbaum, FAMariuzza, RAPoljak, RJ Thermodynamics of antigen-antibody binding using specific anti-lysozyme antibodies. Eur J Biochem 228:388-94 (1995) [PubMed]
Cell React
Prep. Method:
Papain-cleaved antigen binding fragment of F9.13.7 mAb
Name:
F9.13.7 Fab
Synonyms:
n/a
Type:
Protein Complex
Mol. Mass.:
n/a
Description:
n/a
Components:
This complex has 2 components.
Component 1
Name:
F9.13.7 Fab chain H
Synonyms:
n/a
Type:
Enzyme Subunit
Mol. Mass.:
23618.70
Organism:
Mus musculus (mouse)
Description:
n/a
Residue:
221
Sequence:
QVQLQQPGAELVKPGASVKLSCKASGYTFTSYWMHWVKQGPGQGLEWIGEIDPSDSYPNYNEKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYYCASLYYYGTSYGVLDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVP
  
Component 2
Name:
F9.13.7 Fab chain L
Synonyms:
n/a
Type:
Enzyme Subunit
Mol. Mass.:
23809.54
Organism:
Mus musculus (mouse)
Description:
Antibody to hen egg lysozyme
Residue:
214
Sequence:
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQKKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTIRNLEQEDIATYFCQQGYTLPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
  
Syringe React
Source:
Sigma Chemical Co.
Name:
Lysozyme (hen egg)
Synonyms:
D1.3 Fv | D1.3 mAb | hen egg lysozyme (HEL) | hen egg lysozyme(HEL)
Type:
Enzyme
Mol. Mass.:
16805.63
Organism:
Mus musculus (mouse)
Description:
P17897
Residue:
148
Sequence:
MKALLTLGLLLLSVTAQAKVYNRCELARILKRNGMDGYRGVKLADWVCLAQHESNYNTRATNYNRGDRSTDYGIFQINSRYWCNDGKTPRSKNACGINCSALLQDDITAAIQCAKRVVRDPQGIRAWVAWRTQCQNRDLSQYIRNCGV