Target
Dimer of Gag-Pol polyprotein [489-587,K509R,V521I,L522F,M525I,M535I,I543V,L552P,A560V,V571A,I573V,L579M]
Ligand
BDBM580
Substrate
HIV Protease Chromogenic Peptide Substrate
Meas. Tech.
Protease Inhibition Assay
Ki
5.6±n/a nM
Citation
 Clemente, JCMoose, REHemrajani, RWhitford, LRGovindasamy, LReutzel, RMcKenna, RAgbandje-McKenna, MGoodenow, MMDunn, BM Comparing the accumulation of active- and nonactive-site mutations in the HIV-1 protease. Biochemistry 43:12141-51 (2004) [PubMed]  Article
Target
Name:
Dimer of Gag-Pol polyprotein [489-587,K509R,V521I,L522F,M525I,M535I,I543V,L552P,A560V,V571A,I573V,L579M]
Synonyms:
HIV-1 Protease Mutant V6(46/54/84) | HIV-1 protease mutant (K20R V32I L33F M36I M46I I54V L63P A71V V82A I84V L90M)
Type:
Protein Complex
Mol. Mass.:
n/a
Description:
The post-ritonavir therapy protease variant plus M46I/I54V/I84V mutations, which were created by site-directed mutagenesis.
Components:
This complex has 2 components.
Component 1
Name:
Gag-Pol polyprotein [489-587,K509R,V521I,L522F,M525I,M535I,I543V,L552P,A560V,V571A,I573V,L579M]
Synonyms:
HIV-1 Protease Mutant V6(46/54/84) chain A | HIV-1 Protease Mutant V6(46/54/84) chain B
Type:
Enzyme Subunit
Mol. Mass.:
10795.08
Organism:
Human immunodeficiency virus type 1
Description:
P04585[489-587,K509R,V521I,L522F,M525I,M535I,I543V,L552P,A560V,V571A,I573V,L579M]
Residue:
99
Sequence:
PQVTLWQRPLVTIKIGGQLREALLDTGADDTIFEEISLPGRWKPKIIGGIGGFVKVRQYDQIPIEICGHKVIGTVLVGPTPANVIGRNLMTQIGCTLNF
  
Component 2
Name:
Gag-Pol polyprotein [489-587,K509R,V521I,L522F,M525I,M535I,I543V,L552P,A560V,V571A,I573V,L579M]
Synonyms:
HIV-1 Protease Mutant V6(46/54/84) chain A | HIV-1 Protease Mutant V6(46/54/84) chain B
Type:
Enzyme Subunit
Mol. Mass.:
10795.08
Organism:
Human immunodeficiency virus type 1
Description:
P04585[489-587,K509R,V521I,L522F,M525I,M535I,I543V,L552P,A560V,V571A,I573V,L579M]
Residue:
99
Sequence:
PQVTLWQRPLVTIKIGGQLREALLDTGADDTIFEEISLPGRWKPKIIGGIGGFVKVRQYDQIPIEICGHKVIGTVLVGPTPANVIGRNLMTQIGCTLNF
  
Inhibitor
Name:
BDBM580
Synonyms:
(4R)-3-[(2S,3S)-2-hydroxy-3-[(3-hydroxy-2-methylphenyl)formamido]-4-phenylbutanoyl]-5,5-dimethyl-N-[(2-methylphenyl)methyl]-1,3-thiazolidine-4-carboxamide | AG1776 | JE-2147 | KNI-764
Type:
Small organic molecule
Emp. Form.:
n/a
Mol. Mass.:
n/a
SMILES:
n/a
Structure:
Search PDB for entries with ligand similarity:
Substrate
Name:
HIV Protease Chromogenic Peptide Substrate
Synonyms:
n/a
Type:
Peptide
Mol. Mass.:
1420.11
Organism:
n/a
Description:
n/a
Residue:
13
Sequence:
KARVLNPHEANLG