Target
Mitogen-activated protein kinase 1
Ligand
BDBM50169956
Substrate
n/a
Meas. Tech.
ChEMBL_302209 (CHEMBL826982)
Kd
5000±n/a nM
Citation
 Hancock, CNMacias, ALee, EKYu, SYMackerell, ADShapiro, P Identification of novel extracellular signal-regulated kinase docking domain inhibitors. J Med Chem 48:4586-95 (2005) [PubMed]  Article 
Target
Name:
Mitogen-activated protein kinase 1
Synonyms:
ERK2 | ERT1 | Extracellular signal-regulated kinase 2 | Extracellular signal-regulated kinase 2 (ERK-2) | Extracellular signal-regulated kinase 2 (ERK2) | MAP Kinase 2/ERK2 | MAPK 2 | MAPK1 | MK01_HUMAN | Mitogen activated kinase 1 (ERK-2) | Mitogen-activated protein kinase 1 (ERK-2) | Mitogen-activated protein kinase 1 (ERK2) | Mitogen-activated protein kinase 2 | PRKM1 | PRKM2 | p42-MAPK
Type:
Ser/Thr Protein Kinase
Mol. Mass.:
41392.76
Organism:
Homo sapiens (Human)
Description:
P28482
Residue:
360
Sequence:
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
  
Inhibitor
Name:
BDBM50169956
Synonyms:
2-(Benzooxazol-2-ylsulfanyl)-N-(4-tetrazol-1-yl-phenyl)-acetamide | CHEMBL364953
Type:
Small organic molecule
Emp. Form.:
C16H12N6O2S
Mol. Mass.:
352.37
SMILES:
O=C(CSc1nc2ccccc2o1)Nc1ccc(cc1)-n1cnnn1
Structure:
Search PDB for entries with ligand similarity: