Target
2'-deoxynucleoside 5'-phosphate N-hydrolase 1
Ligand
BDBM92532
Substrate
n/a
Meas. Tech.
Inhibition Assay
Kd
1.06e+4± 4e+2 nM
Citation
 Dupouy, CZhang, CPadilla, APochet, SKaminski, PA Probing the active site of the deoxynucleotide N-hydrolase Rcl encoded by the rat gene c6orf108. J Biol Chem 285:41806-14 (2010) [PubMed]  Article 
Target
Name:
2'-deoxynucleoside 5'-phosphate N-hydrolase 1
Synonyms:
DNPH1_RAT | Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl) | Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl) D69N | Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl) E93Q | Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl) S117A | Deoxyribonucleoside 5'-monophosphate N-glycosidase (Rcl) Y13F | Dnph1 | Rcl | c-Myc-responsive protein Rcl
Type:
Enzyme
Mol. Mass.:
17775.23
Organism:
Rattus norvegicus (Rat)
Description:
O35820
Residue:
163
Sequence:
MAASGEQAPCSVYFCGSIRGGREDQALYARIVSRLRRYGKVLTEHVADAELEPLGEEAAGGDQFIHEQDLNWLQQADVVVAEVTQPSLGVGYELGRAVALGKPILCLFRPQSGRVLSAMIRGAADGSRFQVWDYAEGEVETMLDRYFEAYLPQKTASSSHPSA
  
Inhibitor
Name:
BDBM92532
Synonyms:
dGMP
Type:
Small molecule
Emp. Form.:
C10H12N5O7P
Mol. Mass.:
345.2064
SMILES:
Nc1nc2n(cnc2c(=O)[nH]1)C1CC(O)C(COP([O-])([O-])=O)O1
Structure:
Search PDB for entries with ligand similarity: