Target
SYK Kinase
Ligand
BDBM225523
Substrate
n/a
Meas. Tech.
SYK assay_HTRF
IC50
1.41±n/a nM
Citation
 D3R, DD GSK SYK Kinase D3R 225:0 (2015) [PubMed]
Target
Name:
SYK Kinase
Synonyms:
n/a
Type:
n/a
Mol. Mass.:
32610.83
Organism:
Homo sapiens (Human)
Description:
n/a
Residue:
281
Sequence:
PEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN
  
Inhibitor
Name:
BDBM225523
Synonyms:
GTC000229A
Type:
Small Organic Molecule
Emp. Form.:
C23H23N7O4S
Mol. Mass.:
493.538
SMILES:
OC(=O)CCCCN(c1ccnc(Nc2ccc3CNS(=O)(=O)c3c2)n1)c1cccc2[nH]ncc12
Structure:
Search PDB for entries with ligand similarity: