Compile Data Set for Download or QSAR
maximum 50k data
Found 1536 with Last Name = 'fairlie' and Initial = 'dp'
TargetGag-Pol polyprotein [489-587](Human immunodeficiency virus type 1)
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM578((2S)-N-[(2S,4S,5S)-5-[2-(2,6-dimethylphenoxy)aceta...)
Affinity DataKi:  0.00400nMAssay Description:Binding affinity against ritonavir-resistant strains.Checked by AuthorMore data for this Ligand-Target Pair
TargetCathepsin D(Homo sapiens (Human))
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM912((3S,4S)-3-hydroxy-4-[(2S)-2-[(3S,4S)-3-hydroxy-6-m...)
Affinity DataKi:  0.0100nMAssay Description:Binding affinity against human cathepsin DChecked by AuthorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMedMMDB

TargetNeutrophil elastase(Homo sapiens (Human))
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50036477(2,6-Dichloro-3-(2-morpholin-4-yl-ethoxy)-benzoic a...)
Affinity DataKi:  0.0130nMAssay Description:Binding affinity against Elastase.Checked by AuthorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGag-Pol polyprotein [489-587](Human immunodeficiency virus type 1)
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM729((2S,4R)-N-tert-butyl-1-[(2R,3S)-2-hydroxy-3-[(2S)-...)
Affinity DataKi:  0.0310nMAssay Description:Binding affinity against HIV-1 protease .Checked by AuthorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCollagenase 3(Homo sapiens (Human))
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50082556((S)-2,2-Dimethyl-4-[4-(pyridin-4-yloxy)-benzenesul...)
Affinity DataKi:  0.0380nMAssay Description:Inhibition of matrix metalloprotease-13 (MMP-13).Checked by AuthorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProthrombin(Homo sapiens (Human))
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50057826((S)-1-((R)-2-Amino-3,3-dicyclohexyl-propionyl)-pyr...)
Affinity DataKi:  0.0560nMAssay Description:Binding affinity against Thrombin.Checked by AuthorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target72 kDa type IV collagenase(Homo sapiens (Human))
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50082556((S)-2,2-Dimethyl-4-[4-(pyridin-4-yloxy)-benzenesul...)
Affinity DataKi:  0.0830nMAssay Description:Inhibition of matrix metalloprotease-2 (MMP-2).Checked by AuthorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetBcl-2-related protein A1(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50210070(CHEMBL3883565)
Affinity DataKi: <0.100nMAssay Description:Inhibition of FITC-betaA-DIIRNIARHLAQVGDSMRSI-NH2 binding to recombinant human Bcl2A1 (1 to 152 residues) BH3 binding site expressed in Escherichia c...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCoagulation factor X(Homo sapiens (Human))
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50084664(({3-(5-Carbamimidoyl-2-hydroxy-phenoxy)-2,6-difluo...)
Affinity DataKi:  0.100nMAssay Description:Binding affinity against Coagulation factor XChecked by AuthorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231952(CHEMBL4081554)
Affinity DataKi:  0.110nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGenome polyprotein(Human rhinovirus B)
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM729((2S,4R)-N-tert-butyl-1-[(2R,3S)-2-hydroxy-3-[(2S)-...)
Affinity DataKi:  0.134nMAssay Description:Binding affinity against HIV-1 protease .Checked by AuthorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProthrombin(Homo sapiens (Human))
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50084682(1-[3-(4-Carbamimidoyl-phenyl)-2-(2-methyl-1,2,3,4-...)
Affinity DataKi:  0.210nMAssay Description:Binding affinity against Thrombin.Checked by AuthorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target72 kDa type IV collagenase(Homo sapiens (Human))
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM11863(4-({[4-(4-chlorophenoxy)benzene]sulfonyl}methyl)-N...)
Affinity DataKi:  0.220nMAssay Description:Inhibition of matrix metalloprotease-2 (MMP-2).Checked by AuthorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231900(CHEMBL4060480)
Affinity DataKi:  0.230nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetStromelysin-1(Homo sapiens (Human))
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50082556((S)-2,2-Dimethyl-4-[4-(pyridin-4-yloxy)-benzenesul...)
Affinity DataKi:  0.270nMAssay Description:Inhibition of matrix metalloprotease-3 (MMP-3).Checked by AuthorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProthrombin(Homo sapiens (Human))
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50037991(CHEMBL325166 | NAPSAGATRAN | Ro-46-6240 | {[(S)-3-...)
Affinity DataKi:  0.300nMAssay Description:Binding affinity against Thrombin.Checked by AuthorMore data for this Ligand-Target Pair
TargetGag-Pol polyprotein [489-587](Human immunodeficiency virus type 1)
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50369584(CHEMBL1790230)
Affinity DataKi:  0.300nMAssay Description:Tested for inhibition of synthetic HIV-1 protease by using fluorometric assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGag-Pol polyprotein [489-587](Human immunodeficiency virus type 1)
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50369584(CHEMBL1790230)
Affinity DataKi:  0.300nMAssay Description:Inhibitory constant against HIV-1 proteaseMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDimer of Gag-Pol polyprotein [491-589,Q7K,L33I,C67B,C95B](Human immunodeficiency virus type 1)
University Of Queensland

LigandPNGBDBM798((2R)-2-[(7S,10S,13S)-7-amino-10-butyl-8,11-dioxo-2...)
Affinity DataKi:  0.310nM ΔG°:  -56.5kJ/molepH: 6.5 T: 2°CAssay Description:Inhibition constants were determined by a fluorometric assay. Ki values were calculated from either Dixon plots or Henderson plots in cases where the...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50261506(CHEMBL499930 | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2)
Affinity DataKi:  0.320nMAssay Description:Agonist activity at human GLP1R expressed in CHO cells assessed as cAMP accumulation incubated for 30 mins by LANCE assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDimer of Gag-Pol polyprotein [491-589,Q7K,L33I,C67B,C95B](Human immunodeficiency virus type 1)
University Of Queensland

LigandPNGBDBM797((2S)-N-[(7S,10S,13S)-13-[(1R)-2-[(4-aminobenzene)(...)
Affinity DataKi:  0.340nM ΔG°:  -56.2kJ/molepH: 6.5 T: 2°CAssay Description:Inhibition constants were determined by a fluorometric assay. Ki values were calculated from either Dixon plots or Henderson plots in cases where the...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231888(CHEMBL4081357)
Affinity DataKi:  0.350nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCaspase-1(Homo sapiens (Human))
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50068972((S)-3-(2-{3-[(Naphthalene-2-carbonyl)-amino]-2-oxo...)
Affinity DataKi:  0.370nMAssay Description:The binding affinity against IL-1 beta converting enzymeChecked by AuthorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGag-Pol polyprotein [489-587](Human immunodeficiency virus type 1)
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50142990(CHEMBL288836 | N-[(R)-2-Hydroxy-2-((9S,12S)-9-isop...)
Affinity DataKi:  0.400nMAssay Description:Tested for inhibition of synthetic HIV-1 protease by using fluorometric assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNeutrophil elastase(Homo sapiens (Human))
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50058491(3-{4-[2-(4-{1-[4-(2-Carboxy-2-methyl-propane-1-sul...)
Affinity DataKi:  0.450nMAssay Description:Binding affinity against Elastase.Checked by AuthorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine protease 1(Homo sapiens (Human))
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50084686(1-[3-(4-Carbamimidoyl-phenyl)-2-(2-methyl-1,2,3,4-...)
Affinity DataKi:  0.460nMAssay Description:Binding affinity against TrypsinChecked by AuthorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231942(CHEMBL4065403)
Affinity DataKi:  0.470nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231949(CHEMBL4069162)
Affinity DataKi:  0.490nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231943(CHEMBL4093072)
Affinity DataKi:  0.490nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGag-Pol polyprotein [489-587](Human immunodeficiency virus type 1)
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM517((2S)-1-[(2S,4R)-4-benzyl-2-hydroxy-4-{[(1S,2R)-2-h...)
Affinity DataKi:  0.520nMAssay Description:Binding affinity against HIV-1 protease enzyme.Checked by AuthorMore data for this Ligand-Target Pair
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231887(CHEMBL4091638)
Affinity DataKi:  0.520nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCollagenase 3(Homo sapiens (Human))
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM11863(4-({[4-(4-chlorophenoxy)benzene]sulfonyl}methyl)-N...)
Affinity DataKi:  0.520nMAssay Description:Inhibition of matrix metalloprotease-13 (MMP-13).Checked by AuthorMore data for this Ligand-Target Pair
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50086603(CHEMBL3426241)
Affinity DataKi:  0.570nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMatrix metalloproteinase-9(Homo sapiens (Human))
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM11863(4-({[4-(4-chlorophenoxy)benzene]sulfonyl}methyl)-N...)
Affinity DataKi:  0.580nMAssay Description:Inhibition of matrix metalloprotease-9 (MMP-9).Checked by AuthorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGag-Pol polyprotein [489-587](Human immunodeficiency virus type 1)
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50370377(CHEMBL1790231)
Affinity DataKi:  0.600nMAssay Description:Tested for inhibition of synthetic HIV-1 protease by using fluorometric assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGag-Pol polyprotein [489-587](Human immunodeficiency virus type 1)
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50092152(2-Benzyl-5-(10-sec-butyl-9,12-dioxo-2-oxa-8,11-dia...)
Affinity DataKi:  0.600nMAssay Description:Inhibitory constant against HIV-1 proteaseMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDimer of Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A](Human immunodeficiency virus type 1)
University Of Queensland

LigandPNGBDBM13928(2-[(8S,11S)-11-[(1R)-2-[benzene(3-methylbutyl)sulf...)
Affinity DataKi:  0.600nM ΔG°:  -54.8kJ/molepH: 6.5 T: 2°CAssay Description:he Ki values were determined using fluorogenic substrate, 2-(aminobenzoyl)-Thr-Ile-Nle-Phe(p-NO2)-Gln-ArgNH2. A standard curve relating changes in fl...More data for this Ligand-Target Pair
TargetGag-Pol polyprotein [489-587](Human immunodeficiency virus type 1)
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM577((3S)-oxolan-3-yl N-[(2S,3R)-4-[(4-aminobenzene)(2-...)
Affinity DataKi:  0.600nMAssay Description:Binding affinity against HIV-proteaseChecked by AuthorMore data for this Ligand-Target Pair
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50301953((3S,6S,9S,12S,15S,21S)-21-(2-((S)-2-amino-3-(1H-im...)
Affinity DataKi:  0.660nMAssay Description:Displacement of [125I]-17 from human GLP-1R expressed in CHO cell membranes incubated for 120 mins by scintillation counting based radioligand bindin...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRenin(Homo sapiens (Human))
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM17941((2S,4S,5S)-5-[(2S)-2-[(2S)-2-benzyl-3-[(2-methylpr...)
Affinity DataKi:  0.700nMAssay Description:Binding affinity against aspartic protease renin.Checked by AuthorMore data for this Ligand-Target Pair
TargetSerine protease 1(Homo sapiens (Human))
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50084682(1-[3-(4-Carbamimidoyl-phenyl)-2-(2-methyl-1,2,3,4-...)
Affinity DataKi:  0.700nMAssay Description:Binding affinity against TrypsinChecked by AuthorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCathepsin D(Homo sapiens (Human))
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50084670(CHEMBL323806 | N-[3-[2-(2-Bromo-4,5-dimethoxy-phen...)
Affinity DataKi:  0.700nMAssay Description:Binding affinity against aspartic proteasesChecked by AuthorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRenin(Homo sapiens (Human))
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50077669((S)-2-Benzyl-N-[(S)-1-((1S,2R,3S)-1-cyclohexylmeth...)
Affinity DataKi:  0.700nMAssay Description:Binding affinity against aspartic protease renin.Checked by AuthorMore data for this Ligand-Target Pair
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231894(CHEMBL4100325)
Affinity DataKi:  0.800nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231902(CHEMBL4096416)
Affinity DataKi:  0.820nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231962(CHEMBL4099379)
Affinity DataKi:  0.840nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDimer of Gag-Pol polyprotein [491-589,Q7K,L33I,C67B,C95B](Human immunodeficiency virus type 1)
University Of Queensland

LigandPNGBDBM795((2R)-2-[(7S,10S,13S)-7-amino-8,11-dioxo-10-(propan...)
Affinity DataKi:  0.900nM ΔG°:  -53.7kJ/molepH: 6.5 T: 2°CAssay Description:Inhibition constants were determined by a fluorometric assay. Ki values were calculated from either Dixon plots or Henderson plots in cases where the...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
The University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50231896(CHEMBL4084829)
Affinity DataKi:  0.940nMAssay Description:Displacement of [125I]-GLP (7 to 36 residues) from human GLP1R expressed in CHO cell membranes incubated for 30 mins measured after 10 hrs by scintil...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNeutrophil elastase(Homo sapiens (Human))
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50041291(2-[(R)-3-(1,1-Dimethyl-2-phenyl-ethyl)-2,4,8-triox...)
Affinity DataKi:  0.950nMAssay Description:Binding affinity against Elastase.Checked by AuthorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGag-Pol polyprotein [489-587](Human immunodeficiency virus type 1)
University Of Queensland

Curated by ChEMBL
LigandPNGBDBM50142978((S)-11-{(S)-2-[Benzenesulfonyl-(3-methyl-butyl)-am...)
Affinity DataKi:  1nMAssay Description:Tested for inhibition of synthetic HIV-1 protease by using fluorometric assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 1536 total ) | Next | Last >>
Jump to: