BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Lysozyme (hen egg)
Syringe Reactant:HyHEL-10
Meas. Tech.:ITC and CD
Entry Date:12/11/00
 
ΔG°:-50.2±0.75 (kJ/mole)
pH:7.2±n/a
Log10Kb:8.62± 7.30
Temperature:303.15±n/a (K)
ΔH° :-91.5± (kJ/mole)
ΔHobs :-91.5± (kJ/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :-1.42±0.05 (kJ/mole)
Stoich. Param.:1
ΔS° : -0.1366±0.00410 (kJ/mole-K)
Comments:n/a
 
Citation Tsumoto, KOgasahara, KUeda, YWatanabe, KYutani, KKumagai, I Role of salt bridge formation in antigen-antibody interaction. Entropic contribution to the complex between hen egg white lysozyme and its monoclonal antibody HyHEL10. J Biol Chem271:32612-6 (1996) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Instrument Info
 
Lysozyme (hen egg)
Source:Seikagaku Kogyo, Inc. (Tokyo, Japan)
Purity:n/a
Prep. Method:n/a
Name:Lysozyme (hen egg)
Synonyms:FvD1.3(VLW92A) | FvD1.3(VLW92D) | FvD1.3(VLW92F) | FvD1.3(VLW92H) | FvD1.3(VLW92S) | FvD1.3(VLW92V) | FvD1.3(VLW92wt) | hen egg lysozyme (HEL)
Type:Enzyme
Mol. Mass.:16248.07
Organism:Gallus gallus (chicken)
Description:P00698
Residue:147
Sequence:
MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQA
TNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDG
NGMNAWVAWRNRCKGTDVQAWIRGCRL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
HyHEL-10
Source:Secretory expression in E. coli
Purity:n/a
Prep. Method:Affinity chromatography purification procedures using HEL-Sepharose
Name:HyHEL-10
Synonyms:n/a
Type:Antibody
Mol. Mass.:12784.84
Organism:Mus musculus (mouse)
Description:Fv fragment of monoclonal antibody to hen egg white lysozyme
Residue:114
Sequence:
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYN
PSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.