Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin
LigandBDBM17234
Substrate/CompetitorBDBM17139
Meas. Tech.Enzyme Inhibition Assay
Ki>5000±n/a nM
Citation Kochanny, MJAdler, MEwing, JGriedel, BDHo, EKaranjawala, RLee, WLentz, DLiang, AMMorrissey, MMPhillips, GBPost, JSacchi, KLSakata, STSubramanyam, BVergona, RWalters, JWhite, KAWhitlow, MYe, BZhao, ZShaw, KJ Substituted thiophene-anthranilamides as potent inhibitors of human factor Xa. Bioorg Med Chem15:2127-46 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Trypsin
Name:Trypsin I
Synonyms:Beta-Trypsin | Cationic trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:25790.52
Organism:Bos taurus (bovine)
Description:P00760
Residue:246
Sequence:
MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17234
NameBDBM17234
Synonyms:N-{4-chloro-2-[(4-chlorophenyl)carbamoyl]phenyl}-3-[(4-methylpiperazin-1-yl)methyl]-1-benzothiophene-2-carboxamide | benzothiophene compound, 13
TypeSmall organic molecule
Emp. Form.C28H26Cl2N4O2S
Mol. Mass.553.503
SMILESCN1CCN(Cc2c(sc3ccccc23)C(=O)Nc2ccc(Cl)cc2C(=O)Nc2ccc(Cl)cc2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM17139
NameBDBM17139
Synonyms:(2S)-2-[(2R)-2-amino-3-methylbutanamido]-N-[(1S)-4-carbamimidamido-1-[(4-nitrophenyl)carbamoyl]butyl]-4-methylpentanamide dihydrochloride | Chromogenic Substrate S-2266 | H-D-Val-Leu-Arg-pNA 2HCl | H-D-Val-Leu-Arg-pNA · 2HCl | H-D-Valyl-L-leucyl-L-argininep-Nitroaniline dihydrochloride
TypeSmall organic molecule
Emp. Form.C23H38N8O5
Mol. Mass.506.5984
SMILESCC(C)CC(NC(=O)C(N)C(C)C)C(=O)NC(CCC\[NH+]=C(/N)[NH-])C(=O)Nc1ccc(cc1)[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: