Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysine-specific histone demethylase 1A
LigandBDBM256661
Substrate/Competitorn/a
Meas. Tech.LSD1 Inhibitory Activity
pH8±n/a
Temperature298.15±n/a K
IC50<100.0±n/a nM
Commentsextracted
Citation Matsumoto, SHattori, YToyofuku, MMorimoto, SDaini, MKojima, TKaku, TIto, M Cyclopropanamine compound and use thereof US Patent US10053456 Publication Date 8/21/2018
More Info.:Get all data from this article,  Assay Method
 
Lysine-specific histone demethylase 1A
Name:Lysine-specific histone demethylase 1A
Synonyms:AOF2 | BRAF35-HDAC complex protein BHC110 | Flavin-containing amine oxidase domain-containing protein 2 | KDM1 | KIAA0601 | LSD1 | Lysine-specific demethylase 1 (LSD1) | Lysine-specific histone demethylase 1 | Lysine-specific histone demethylase 1 (LSD1)
Type:Enzyme
Mol. Mass.:92901.01
Organism:Homo sapiens (Human)
Description:O60341
Residue:852
Sequence:
MLSGKKAAAAAAAAAAAATGTEAGPGTAGGSENGSEVAAQPAGLSGPAEVGPGAVGERTP
RKKEPPRASPPGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGRRTSRRKRAKVEY
REMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQ
SRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEA
PYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGKVIIIGSGVSGLAAARQLQSF
GMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKC
PLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQE
KHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLV
KSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFAN
ATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGC
EVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNLN
KVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENISD
DVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPI
TPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQA
TPGVPAQQSPSM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM256661
NameBDBM256661
Synonyms:BDBM256662 | US10053456, 41 | US9487511, 40 | US9718814, 41
TypeSmall organic molecule
Emp. Form.C17H22N4O2S2
Mol. Mass.378.512
SMILESCc1nnc(NC(=O)c2csc(c2)C2CC2NCC2CCOCC2)s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a