Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor
LigandBDBM50242116
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1671313
Ki 1.6±n/a nM
Citation Basu, SBarawkar, DARamdas, VPatel, MWaman, YPanmand, AKumar, SThorat, SNaykodi, MGoswami, AReddy, BSPrasad, VChaturvedi, SQuraishi, AMenon, SPaliwal, SKulkarni, AKarande, VGhosh, IMustafa, SDe, SJain, VBanerjee, ERRouduri, SRPalle, VPChugh, AMookhtiar, KA Design and synthesis of novel xanthine derivatives as potent and selective A Eur J Med Chem134:218-229 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor
Name:Adenosine receptor
Synonyms:ADENOSINE A2B | ADORA2B | Adenosine receptor A2B (A2B)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:36341.22
Organism:Homo sapiens (Human)
Description:n/a
Residue:332
Sequence:
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA
IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT
RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT
FHKIISRYLLCQADVKSGNGQAGVQPALGVGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50242116
NameBDBM50242116
Synonyms:CHEMBL4079273
TypeSmall organic molecule
Emp. Form.C20H17FN6O2
Mol. Mass.392.3864
SMILESCCCn1c(=O)[nH]c2nc([nH]c2c1=O)-c1cnn(CC#Cc2ccc(F)cc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a