Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-lactamase (TEM-1)
LigandBDBM50076678
Substrate/Competitorn/a
Meas. Tech.ChEBML_197642
IC50 650±n/a nM
Citation Buynak, JDChen, HVogeti, LGadhachanda, VRBuchanan, CAPalzkill, TShaw, RWSpencer, JWalsh, TR Penicillin-derived inhibitors that simultaneously target both metallo- and serine-beta-lactamases. Bioorg Med Chem Lett14:1299-304 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-lactamase (TEM-1)
Name:Bacterial beta-lactamase TEM
Synonyms:Bacterial beta-lactamase TEM | Beta-lactamase TEM | Beta-lactamase TEM-1 | Beta-lactamase TEM-1b | Beta-lactamase TEM1D | Beta-lactamase TEM1E | Beta-lactamase TEM1F | TEM beta lactamase | TEM extended-spectrum beta-lactamase | TEM-1 beta-lactamase
Type:Enzyme
Mol. Mass.:31512.33
Organism:Escherichia coli
Description:P62593
Residue:286
Sequence:
MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP
EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL
CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM
PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS
RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50076678
NameBDBM50076678
Synonyms:(2S,5R,6R)-6-Hydroxymethyl-3,3-dimethyl-4,4,7-trioxo-4lambda*6*-thia-1-aza-bicyclo[3.2.0]heptane-2-carboxylic acid | (2S,5R,6R)-6-Hydroxymethyl-3,3-dimethyl-4,4,7-trioxo-4lambda*6*-thia-1-aza-bicyclo[3.2.0]heptane-2-carboxylic acid anion | CHEMBL416561
TypeSmall organic molecule
Emp. Form.C9H13NO6S
Mol. Mass.263.268
SMILESCC1(C)[C@@H](N2[C@@H]([C@H](CO)C2=O)S1(=O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a