Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEstradiol 17-beta-dehydrogenase 2
LigandBDBM50330992
Substrate/Competitorn/a
Meas. Tech.ChEMBL_684637
IC50 18±n/a nM
Citation Oster, AHinsberger, SWerth, RMarchais-Oberwinkler, SFrotscher, MHartmann, RW Bicyclic substituted hydroxyphenylmethanones as novel inhibitors of 17ß-hydroxysteroid dehydrogenase type 1 (17ß-HSD1) for the treatment of estrogen-dependent diseases. J Med Chem53:8176-86 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Estradiol 17-beta-dehydrogenase 2
Name:Estradiol 17-beta-dehydrogenase 2
Synonyms:17-beta-Hydroxysteroid Dehydrogenase 2 (17-beta-HSD2) | 20 alpha-hydroxysteroid dehydrogenase | 20-alpha-HSD | Estradiol 17-beta-dehydrogenase 2 (17beta-HSD2) | Microsomal 17-beta-hydroxysteroid dehydrogenas | Testosterone 17-beta-dehydrogenase
Type:Oxidoreductase; single-pass type II membrane protein
Mol. Mass.:42795.29
Organism:Homo sapiens (Human)
Description:Enzyme was partially purified from human placenta.
Residue:387
Sequence:
MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLIL
FSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPG
AEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELL
LMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVT
MFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYI
LAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYD
YFAKRHFGQDKPMPRALRMPNYKKKAT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50330992
NameBDBM50330992
Synonyms:(3-hydroxyphenyl)(5-(2-hydroxyphenyl)thiophen-2-yl)methanone | CHEMBL1277341
TypeSmall organic molecule
Emp. Form.C17H12O3S
Mol. Mass.296.34
SMILESOc1cccc(c1)C(=O)c1ccc(s1)-c1ccccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a