Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetExtracellular signal-regulated kinase 5 (ERK5)
LigandBDBM50337141
Substrate/Competitorn/a
Meas. Tech.ChEMBL_719091
IC50 200±n/a nM
Citation Deng, XYang, QKwiatkowski, NSim, TMcDermott, USettleman, JELee, JDGray, NS Discovery of a benzo[e]pyrimido-[5,4-b][1,4]diazepin-6(11H)-one as a Potent and Selective Inhibitor of Big MAP Kinase 1. ACS Med Chem Lett2:195-200 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Extracellular signal-regulated kinase 5 (ERK5)
Name:Extracellular signal-regulated kinase 5 (ERK5)
Synonyms:Big MAP kinase 1 | ERK5 | Mitogen-activated protein kinase 7
Type:Protein
Mol. Mass.:88377.36
Organism:Homo sapiens (Human)
Description:Q13164
Residue:816
Sequence:
MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCAMESPPPAPPPCPGPAPDTIDLTLQPPPPVSEPAPPKKDGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPAAPALTSVPAPAPAPTPTPTPV
QPTSPPPGPVAQPTGPQPQSAGSTSGPVPQPACPPPGPAPHPTGPPGPIPVPAPPQIATS
TSLLAAQSLVPPPGLPGSSTPGVLPYFPPGLPPPDAGGAPQSSMSESPDVNLVTQQLSKS
QVEDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLAD
WLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50337141
n/a
NameBDBM50337141
Synonyms:11-cyclopentyl-2-((2-methoxy-4-(4-methylpiperazin-1-yl)phenyl)amino)-5-methyl-5H-benzo[e]pyrimido[5,4-b][1,4]diazepin-6(11H)-one | CHEMBL1673053
TypeSmall organic molecule
Emp. Form.C29H35N7O2
Mol. Mass.513.6339
SMILESCOc1cc(ccc1Nc1ncc2N(C)C(=O)c3ccccc3N(C3CCCC3)c2n1)N1CCN(C)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: