Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeptidyl-prolyl cis-trans isomerase D
LigandBDBM50169545
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1578414
IC50 1490±n/a nM
Citation Valasani, KRSun, QFang, DZhang, ZYu, QGuo, YLi, JRoy, AShiDu Yan, S Identification of a Small Molecule Cyclophilin D Inhibitor for Rescuing Aß-Mediated Mitochondrial Dysfunction. ACS Med Chem Lett7:294-9 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peptidyl-prolyl cis-trans isomerase D
Name:Peptidyl-prolyl cis-trans isomerase D
Synonyms:40 kDa peptidyl-prolyl cis-trans isomerase | CYP-40 | Cyclophilin-40 | Cyclophilin-related protein | PPIase D | Peptidyl-prolyl cis-trans isomerase D | Rotamase D
Type:Protein
Mol. Mass.:40766.62
Organism:Homo sapiens (Human)
Description:Q08752
Residue:370
Sequence:
MSHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGH
TTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM
ANAGRNTNGSQFFITTVPTPHLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAE
CGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKNIGNTFFKSQNWE
MAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIGACKLKMSNWQGAIDSCLEAL
ELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDK
EKAVYAKMFA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50169545
NameBDBM50169545
Synonyms:CHEMBL3805631
TypeSmall organic molecule
Emp. Form.C22H22N4O4S2
Mol. Mass.470.564
SMILESCC(C)COc1ccc(cc1C#N)-c1nc(C)c(s1)C(=O)Nc1ccc(cc1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a