Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-lactamase
LigandBDBM50195796
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1617950
IC50 18000±n/a nM
Citation Lund, BAChristopeit, TGuttormsen, YBayer, ALeiros, HK Screening and Design of Inhibitor Scaffolds for the Antibiotic Resistance Oxacillinase-48 (OXA-48) through Surface Plasmon Resonance Screening. J Med Chem59:5542-54 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-lactamase
Name:Beta-lactamase
Synonyms:Beta-lactamase | OXA-48 | Synonyms=blaOXA-48 | bla
Type:PROTEIN
Mol. Mass.:30363.94
Organism:Klebsiella pneumoniae
Description:ChEMBL_103606
Residue:265
Sequence:
MRVLALSAVFLVASIIGMPAVAKEWQENKSWNAHFTEHKSQGVVVLWNENKQQGFTNNLK
RANQAFLPASTFKIPNSLIALDLGVVKDEHQVFKWDGQTRDIATWNRDHNLITAMKYSVV
PVYQEFARQIGEARMSKMLHAFDYGNEDISGNVDSFWLDGGIRISATEQISFLRKLYHNK
LHVSERSQRIVKQAMLTEANGDYIIRAKTGYSTRIEPKIGWWVGWVELDDNVWFFAMNMD
MPTSDGLGLRQAITKEVLKQEKIIP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50195796
NameBDBM50195796
Synonyms:CHEMBL3910343
TypeSmall organic molecule
Emp. Form.C17H12N2O2
Mol. Mass.276.2894
SMILESOC(=O)c1cc(cc(c1)-c1ccncc1)-c1ccncc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a