Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFerrochelatase R115L (FECH)
LigandBDBM50396483
Substrate/Competitorn/a
Meas. Tech.Competition Binding Assays
Kd 1.3e+3± 0 nM
Citation Klaeger, SGohlke, BPerrin, JGupta, VHeinzlmeir, SHelm, DQiao, HBergamini, GHanda, HSavitski, MMBantscheff, MMédard, GPreissner, RKuster, B Chemical Proteomics Reveals Ferrochelatase as a Common Off-target of Kinase Inhibitors. ACS Chem Biol11:1245-54 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ferrochelatase R115L (FECH)
Name:Ferrochelatase R115L (FECH)
Synonyms:n/a
Type:Protein
Mol. Mass.:47832.73
Organism:Homo sapiens (Human)
Description:Mutant R115L used for experiment
Residue:423
Sequence:
MRSLGANMAAALRAAGVLLRDPLASSSWRVCQPWRWKSGAAAAAVTTETAQHAQGAKPQV
QPQKRKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRLTPKIQ
EQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERD
GLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADH
ILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLV
WQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKEC
GVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTS
QQL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50396483
NameBDBM50396483
Synonyms:PLX-4032 | RG 7204 | Ro 5185426 | US9388165, Reference, Vemurafenib (PLX-4032) | USRE47451, PLX-4032, Roche | VEMURAFENIB
TypeSmall organic molecule
Emp. Form.C23H18ClF2N3O3S
Mol. Mass.489.922
SMILESCCCS(=O)(=O)Nc1ccc(F)c(C(=O)c2c[nH]c3ncc(cc23)-c2ccc(Cl)cc2)c1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a