Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTwik-RElated Potassium (K+) channel 1 (TREK1)
LigandBDBM10849
Substrate/Competitorn/a
Meas. Tech.TREK1 Assay
pH7.3±n/a
Temperature295.15±n/a K
EC50 377000±n/a nM
Commentsextracted
Citation Viswanath, ANJung, SYHwang, EMPark, KDLim, SMMin, SJCho, YSPae, AN Identification of the first in silico-designed TREK1 antagonists that block channel currents dose dependently. Chem Biol Drug Des88:807-819 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Twik-RElated Potassium (K+) channel 1 (TREK1)
Name:Twik-RElated Potassium (K+) channel 1 (TREK1)
Synonyms:KCNK2 | Outward rectifying potassium channel protein TREK-1 | Potassium channel subfamily K member 2 | TREK | TREK-1 K(+) channel subunit | TREK1 | Two pore domain potassium channel TREK-1 | Two pore potassium channel TPKC1
Type:Protein
Mol. Mass.:47099.16
Organism:Homo sapiens (Human)
Description:O95069
Residue:426
Sequence:
MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWK
TVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQ
IVAAINAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALL
GIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVAL
PAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYF
AAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATS
IKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNGLTPHCAGEEIA
VIENIK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10849
NameBDBM10849
Synonyms:1,3,7-trimethyl-2,3,6,7-tetrahydro-1H-purine-2,6-dione | 1,3,7-trimethyl-3,7-dihydropurine-2,6-dione | CHEMBL113 | Caffeine (1,3,7-trimethylxanthine) | caffeine
TypeSmall organic molecule
Emp. Form.C8H10N4O2
Mol. Mass.194.1906
SMILESCn1cnc2n(C)c(=O)n(C)c(=O)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a