Compile Data Set for Download or QSAR
maximum 50k data
Found 2 of ic50 for monomerid = 239987
TargetTyrosine-protein kinase JAK1(Homo sapiens (Human))
Calitor Sciences

US Patent
LigandPNGBDBM239987(US9403801, 69)
Affinity DataIC50:  15nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent
TargetTyrosine-protein kinase JAK2(Homo sapiens (Human))
Calitor Sciences

US Patent
LigandPNGBDBM239987(US9403801, 69)
Affinity DataIC50:  41nMpH: 7.0 T: 2°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent