Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-X-C chemokine receptor type 4 (CXCR4)
LigandBDBM50166087
Substrate/Competitorn/a
Meas. Tech.ChEMBL_306317
IC50 4.3±n/a nM
Citation Tamamura, HAraki, TUeda, SWang, ZOishi, SEsaka, ATrent, JONakashima, HYamamoto, NPeiper, SCOtaka, AFujii, N Identification of novel low molecular weight CXCR4 antagonists by structural tuning of cyclic tetrapeptide scaffolds. J Med Chem48:3280-9 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-X-C chemokine receptor type 4 (CXCR4)
Name:C-X-C chemokine receptor type 4
Synonyms:C-X-C chemokine receptor type 4 | CD_antigen=CD184 | CXC-R4 | CXCR-4 | FB22 | Fusin | HM89 | LCR1 | LESTR | Leukocyte-derived seven transmembrane domain receptor | NPYRL | SDF-1 receptor | Stromal cell-derived factor 1 receptor
Type:Enzyme
Mol. Mass.:39754.61
Organism:Homo sapiens (Human)
Description:P61073
Residue:352
Sequence:
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVI
LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL
YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA
DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT
TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50166087
NameBDBM50166087
Synonyms:CHEMBL436097 | N-{3-[(2R,5S,8S,14R)-5-(3-Guanidino-propyl)-14-(4-hydroxy-benzyl)-8-naphthalen-2-ylmethyl-3,6,9,12,15-pentaoxo-1,4,7,10,13pentaaza-cyclopentadec-2-yl]-propyl}-guanidine
TypeSmall organic molecule
Emp. Form.C36H47N11O6
Mol. Mass.729.8285
SMILESNC(=N)NCCC[C@@H]1NC(=O)[C@@H](CCCNC(N)=N)NC(=O)[C@@H](Cc2ccc(O)cc2)NC(=O)CNC(=O)[C@H](Cc2ccc3ccccc3c2)NC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a