Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:Inhibition of Escherichia coli LpxCMore data for this Ligand-Target Pair
Affinity DataKi: 2.5nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 7nMAssay Description:Displacement of 3H-RL338 from human GPR6 expressed in T-REx-CHO-GPR6 cells assessed as inhibition constant by competition binding assayMore data for this Ligand-Target Pair
Affinity DataKi: 8nMAssay Description:Binding affinity to human prostaglandin D2 receptor by cell based radioligand displacement assayMore data for this Ligand-Target Pair
Affinity DataKi: 9.40nMAssay Description:Displacement of 3H-RL338 from human GPR6 expressed in T-REx-CHO-GPR6 cells assessed as inhibition constant by competition binding assayMore data for this Ligand-Target Pair
Affinity DataKi: 10nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
Affinity DataKi: 12nMAssay Description:Binding affinity to human prostaglandin D2 receptor by cell based radioligand displacement assayMore data for this Ligand-Target Pair
Affinity DataKi: 13nMAssay Description:Binding affinity to human prostaglandin D2 receptor by cell based radioligand displacement assayMore data for this Ligand-Target Pair
Affinity DataKi: 13nMAssay Description:Inhibitory activity of the compound for PGD2-mediated receptor activation in a fluorescence assay that measures changes in intracellular calciumMore data for this Ligand-Target Pair
Affinity DataKi: 16nMAssay Description:Displacement of 3H-RL338 from human GPR6 expressed in T-REx-CHO-GPR6 cells assessed as inhibition constant by competition binding assayMore data for this Ligand-Target Pair
Affinity DataKi: 18nMAssay Description:Inhibitory activity of the compound for binding of PGD-2 in hTP binding assay using HEK293 cell membranesMore data for this Ligand-Target Pair
Affinity DataKi: 18nMAssay Description:Binding affinity to human prostaglandin D2 receptor by cell based radioligand displacement assayMore data for this Ligand-Target Pair
Affinity DataKi: 20nMAssay Description:Inhibitory activity of the compound for PGD2-mediated receptor activation in a fluorescence assay that measures changes in intracellular calciumMore data for this Ligand-Target Pair
Affinity DataKi: 20nMAssay Description:Inhibition of Escherichia coli LpxCMore data for this Ligand-Target Pair
Affinity DataKi: 23nMAssay Description:Binding affinity to human prostaglandin D2 receptor by cell based radioligand displacement assayMore data for this Ligand-Target Pair
Affinity DataKi: 28nMAssay Description:Antagonist activity at human prostaglandin D2 receptor assessed as inhibition of PGD2-induced receptor activation by cell based FLIPR assayMore data for this Ligand-Target Pair
Affinity DataKi: 29nMAssay Description:Binding affinity to human prostaglandin D2 receptor by cell based radioligand displacement assayMore data for this Ligand-Target Pair
Affinity DataKi: 30nMAssay Description:Inhibitory activity of the compound for binding of PGD-2 to CRTH-2 in hCRTH-2 binding assay using HEK293 cell membranesMore data for this Ligand-Target Pair
Affinity DataKi: 35nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 35nMAssay Description:Binding affinity to human prostaglandin D2 receptor by cell based radioligand displacement assayMore data for this Ligand-Target Pair
Affinity DataKi: 38nMAssay Description:Binding affinity to human prostaglandin D2 receptor by cell based radioligand displacement assayMore data for this Ligand-Target Pair
Affinity DataKi: 50nMAssay Description:Inhibition of Escherichia coli LpxCMore data for this Ligand-Target Pair
Affinity DataKi: 50nMAssay Description:Inhibitory activity of the compound for PGD2-mediated receptor activation in a fluorescence assay that measures changes in intracellular calciumMore data for this Ligand-Target Pair
Affinity DataKi: 100nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
Affinity DataKi: 100nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Mus musculus (Mouse))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 130nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Mus musculus (Mouse))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 130nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Mus musculus (Mouse))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 150nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
Affinity DataKi: 150nMAssay Description:Inhibitory activity of the compound for PGD2-mediated receptor activation in a fluorescence assay that measures changes in intracellular calciumMore data for this Ligand-Target Pair
Affinity DataKi: 170nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
Affinity DataKi: 200nMAssay Description:Inhibitory activity of the compound for PGD2-mediated receptor activation in a fluorescence assay that measures changes in intracellular calciumMore data for this Ligand-Target Pair
Affinity DataKi: 210nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
Affinity DataKi: 220nMAssay Description:Binding affinity to human prostaglandin D2 receptor by cell based radioligand displacement assayMore data for this Ligand-Target Pair
Affinity DataKi: 230nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
Affinity DataKi: 250nMAssay Description:Inhibitory activity of the compound for binding of PGD-2 to CRTH-2 in hCRTH-2 binding assay using HEK293 cell membranesMore data for this Ligand-Target Pair
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Mus musculus (Mouse))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 250nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
Affinity DataKi: 250nMAssay Description:Inhibitory activity of the compound against CRTH-2 in hCRTH-2 binding assay using HEK293 cell membranesMore data for this Ligand-Target Pair
Affinity DataKi: 260nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
Affinity DataKi: 290nMAssay Description:Inhibitory activity of the compound for PGD2-mediated receptor activation in a fluorescence assay that measures changes in intracellular calciumMore data for this Ligand-Target Pair
Affinity DataKi: 290nMAssay Description:Inhibitory activity of the compound for binding of PGD-2 to CRTH-2 in hCRTH-2 binding assay using HEK293 cell membranesMore data for this Ligand-Target Pair
TargetPhosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform(Mus musculus (Mouse))
Pfizer
Curated by ChEMBL
Pfizer
Curated by ChEMBL
Affinity DataKi: 320nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair