Compile Data Set for Download or QSAR
maximum 50k data
Found 952 with Last Name = 'murphy' and Initial = 's'
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361648(CHEMBL1940246)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361649(CHEMBL1938415)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)
Affinity DataKi:  0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361641(CHEMBL1940247)
Affinity DataKi:  0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361652(CHEMBL1940250)
Affinity DataKi:  1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361650(CHEMBL1940248)
Affinity DataKi:  1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361643(CHEMBL1940252)
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361644(CHEMBL1940253)
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361653(CHEMBL1940245)
Affinity DataKi:  2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetUDP-3-O-acyl-N-acetylglucosamine deacetylase(Escherichia coli)
Pfizer

Curated by ChEMBL
LigandPNGBDBM50200120(CHEMBL260091 | CHIR-090 | US10875832, Compound ChI...)
Affinity DataKi:  2nMAssay Description:Inhibition of Escherichia coli LpxCMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361651(CHEMBL1940249)
Affinity DataKi:  2.5nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetG-protein coupled receptor 6(Homo sapiens (Human))
Takeda California

Curated by ChEMBL
LigandPNGBDBM50582430(CHEMBL4598390)
Affinity DataKi:  7nMAssay Description:Displacement of 3H-RL338 from human GPR6 expressed in T-REx-CHO-GPR6 cells assessed as inhibition constant by competition binding assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Athersys

Curated by ChEMBL
LigandPNGBDBM50319488(CHEMBL1084901 | rac-{5-Chloro-3-[2-(3,5-dimethyl-i...)
Affinity DataKi:  8nMAssay Description:Binding affinity to human prostaglandin D2 receptor by cell based radioligand displacement assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetG-protein coupled receptor 6(Homo sapiens (Human))
Takeda California

Curated by ChEMBL
LigandPNGBDBM50582450(CHEMBL4778540)
Affinity DataKi:  9.40nMAssay Description:Displacement of 3H-RL338 from human GPR6 expressed in T-REx-CHO-GPR6 cells assessed as inhibition constant by competition binding assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361651(CHEMBL1940249)
Affinity DataKi:  10nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Athersys

Curated by ChEMBL
LigandPNGBDBM50319486(CHEMBL1084893 | rac-{3-[2-(3,5-Dimethyl-isoxazol-4...)
Affinity DataKi:  12nMAssay Description:Binding affinity to human prostaglandin D2 receptor by cell based radioligand displacement assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Athersys

Curated by ChEMBL
LigandPNGBDBM50319487(CHEMBL1084894 | rac-{2-Methyl-3-[2-(3-methyl-5-phe...)
Affinity DataKi:  13nMAssay Description:Binding affinity to human prostaglandin D2 receptor by cell based radioligand displacement assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Athersys

Curated by ChEMBL
LigandPNGBDBM50162903(CHEMBL359855 | [6-(4-Fluoro-benzenesulfonylamino)-...)
Affinity DataKi:  13nMAssay Description:Inhibitory activity of the compound for PGD2-mediated receptor activation in a fluorescence assay that measures changes in intracellular calciumMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetG-protein coupled receptor 6(Homo sapiens (Human))
Takeda California

Curated by ChEMBL
LigandPNGBDBM50582449(CHEMBL5093828)
Affinity DataKi:  16nMAssay Description:Displacement of 3H-RL338 from human GPR6 expressed in T-REx-CHO-GPR6 cells assessed as inhibition constant by competition binding assayMore data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetThromboxane A2 receptor(Homo sapiens (Human))
Athersys

Curated by ChEMBL
LigandPNGBDBM50161746((R)-3-(3-(4-fluorophenylsulfonamido)-1,2,3,4-tetra...)
Affinity DataKi:  18nMAssay Description:Inhibitory activity of the compound for binding of PGD-2 in hTP binding assay using HEK293 cell membranesMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Athersys

Curated by ChEMBL
LigandPNGBDBM50319482(CHEMBL1082939 | rac-{3-[2-(3,5-Dimethyl-isoxazol-4...)
Affinity DataKi:  18nMAssay Description:Binding affinity to human prostaglandin D2 receptor by cell based radioligand displacement assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Athersys

Curated by ChEMBL
LigandPNGBDBM50162894(CHEMBL361972 | [2-(4-Fluoro-benzenesulfonylamino)-...)
Affinity DataKi:  20nMAssay Description:Inhibitory activity of the compound for PGD2-mediated receptor activation in a fluorescence assay that measures changes in intracellular calciumMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetUDP-3-O-acyl-N-acetylglucosamine deacetylase(Escherichia coli)
Pfizer

Curated by ChEMBL
LigandPNGBDBM50478376(BB-78485 | CHEMBL261713)
Affinity DataKi:  20nMAssay Description:Inhibition of Escherichia coli LpxCMore data for this Ligand-Target Pair
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Athersys

Curated by ChEMBL
LigandPNGBDBM50319495(CHEMBL1082610 | rac-{3-[2-(3,5-Dimethyl-isoxazol-4...)
Affinity DataKi:  23nMAssay Description:Binding affinity to human prostaglandin D2 receptor by cell based radioligand displacement assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Athersys

Curated by ChEMBL
LigandPNGBDBM50319486(CHEMBL1084893 | rac-{3-[2-(3,5-Dimethyl-isoxazol-4...)
Affinity DataKi:  28nMAssay Description:Antagonist activity at human prostaglandin D2 receptor assessed as inhibition of PGD2-induced receptor activation by cell based FLIPR assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Athersys

Curated by ChEMBL
LigandPNGBDBM50319490(CHEMBL1084903 | rac-{3-[1,1-Dioxo-2-(2-phenoxy-eth...)
Affinity DataKi:  29nMAssay Description:Binding affinity to human prostaglandin D2 receptor by cell based radioligand displacement assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Athersys

Curated by ChEMBL
LigandPNGBDBM50162917(CHEMBL360288 | [6-(4-Fluoro-benzenesulfonylamino)-...)
Affinity DataKi:  30nMAssay Description:Inhibitory activity of the compound for binding of PGD-2 to CRTH-2 in hCRTH-2 binding assay using HEK293 cell membranesMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361647(CHEMBL1940244)
Affinity DataKi:  35nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Athersys

Curated by ChEMBL
LigandPNGBDBM50319491(CHEMBL1083446 | rac-(3-{2-[2-(4-Chloro-phenoxy)-et...)
Affinity DataKi:  35nMAssay Description:Binding affinity to human prostaglandin D2 receptor by cell based radioligand displacement assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Athersys

Curated by ChEMBL
LigandPNGBDBM50319494(CHEMBL1085069 | rac-{3-[2-(3,5-Dimethyl-isoxazol-4...)
Affinity DataKi:  38nMAssay Description:Binding affinity to human prostaglandin D2 receptor by cell based radioligand displacement assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetUDP-3-O-acyl-N-acetylglucosamine deacetylase(Escherichia coli)
Pfizer

Curated by ChEMBL
LigandPNGBDBM50074960((R)-2-(3,4-Dimethoxy-5-propyl-phenyl)-4,5-dihydro-...)
Affinity DataKi:  50nMAssay Description:Inhibition of Escherichia coli LpxCMore data for this Ligand-Target Pair
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Athersys

Curated by ChEMBL
LigandPNGBDBM50162891(CHEMBL179980 | [6-(4-Fluoro-benzenesulfonylamino)-...)
Affinity DataKi:  50nMAssay Description:Inhibitory activity of the compound for PGD2-mediated receptor activation in a fluorescence assay that measures changes in intracellular calciumMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361652(CHEMBL1940250)
Affinity DataKi:  100nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361646(CHEMBL1940243)
Affinity DataKi:  100nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50361642(CHEMBL1940251)
Affinity DataKi:  130nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50361653(CHEMBL1940245)
Affinity DataKi:  130nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50361652(CHEMBL1940250)
Affinity DataKi:  150nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Athersys

Curated by ChEMBL
LigandPNGBDBM50162896(CHEMBL369330 | [3-tert-Butyl-6-(4-fluoro-benzenesu...)
Affinity DataKi:  150nMAssay Description:Inhibitory activity of the compound for PGD2-mediated receptor activation in a fluorescence assay that measures changes in intracellular calciumMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)
Affinity DataKi:  170nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Athersys

Curated by ChEMBL
LigandPNGBDBM50162901(CHEMBL180733 | [5-(4-Fluoro-benzenesulfonylamino)-...)
Affinity DataKi:  200nMAssay Description:Inhibitory activity of the compound for PGD2-mediated receptor activation in a fluorescence assay that measures changes in intracellular calciumMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361648(CHEMBL1940246)
Affinity DataKi:  210nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Athersys

Curated by ChEMBL
LigandPNGBDBM50319489(CHEMBL1084902 | rac-[3-(1,1-Dioxo-2-phenethyl-2,3-...)
Affinity DataKi:  220nMAssay Description:Binding affinity to human prostaglandin D2 receptor by cell based radioligand displacement assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361650(CHEMBL1940248)
Affinity DataKi:  230nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Athersys

Curated by ChEMBL
LigandPNGBDBM50162897(3-[6-(4-Fluoro-benzenesulfonylamino)-1,2,3,4-tetra...)
Affinity DataKi:  250nMAssay Description:Inhibitory activity of the compound for binding of PGD-2 to CRTH-2 in hCRTH-2 binding assay using HEK293 cell membranesMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50361647(CHEMBL1940244)
Affinity DataKi:  250nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Athersys

Curated by ChEMBL
LigandPNGBDBM50162897(3-[6-(4-Fluoro-benzenesulfonylamino)-1,2,3,4-tetra...)
Affinity DataKi:  250nMAssay Description:Inhibitory activity of the compound against CRTH-2 in hCRTH-2 binding assay using HEK293 cell membranesMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRAC-alpha serine/threonine-protein kinase(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361649(CHEMBL1938415)
Affinity DataKi:  260nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Athersys

Curated by ChEMBL
LigandPNGBDBM50161746((R)-3-(3-(4-fluorophenylsulfonamido)-1,2,3,4-tetra...)
Affinity DataKi:  290nMAssay Description:Inhibitory activity of the compound for PGD2-mediated receptor activation in a fluorescence assay that measures changes in intracellular calciumMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetProstaglandin D2 receptor 2(Homo sapiens (Human))
Athersys

Curated by ChEMBL
LigandPNGBDBM50161746((R)-3-(3-(4-fluorophenylsulfonamido)-1,2,3,4-tetra...)
Affinity DataKi:  290nMAssay Description:Inhibitory activity of the compound for binding of PGD-2 to CRTH-2 in hCRTH-2 binding assay using HEK293 cell membranesMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50361648(CHEMBL1940246)
Affinity DataKi:  320nMAssay Description:Inhibition of mouse PI3Kalpha after 30 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 952 total ) | Next | Last >>
Jump to: