BDBM194639 US9206139, 2
SMILES CC[C@H](Cc1ccc(cc1)C(F)(F)F)C(=O)NC[C@]1(NC(=O)NC1=O)C1CC1
InChI Key InChIKey=XTJBTJMEXZEGIF-XIKOKIGWSA-N
Data 22 IC50
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 22 hits for monomerid = 194639
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly
US Patent
Eli Lilly
US Patent
Affinity DataIC50: 2nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
Affinity DataIC50: 1.50E+4nMAssay Description:Inhibition of human MMP3 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
TargetADAM metallopeptidase with thrombospondin type 1 motif 4(Canis lupus familiaris (Dog))
Eli Lilly
US Patent
Eli Lilly
US Patent
Affinity DataIC50: 1nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
TargetADAM metallopeptidase with thrombospondin type 1 motif, 5(Rattus norvegicus (Rat))
Eli Lilly
US Patent
Eli Lilly
US Patent
Affinity DataIC50: 20nMAssay Description:The AlphaScreen Assay is modified to include the testing of inhibitors against ADAMTS-5 in the presence of 50% Lewis rat plasma in order to determine...More data for this Ligand-Target Pair
TargetADAM metallopeptidase with thrombospondin type 1 motif 4(Canis lupus familiaris (Dog))
Eli Lilly
US Patent
Eli Lilly
US Patent
Affinity DataIC50: 326nMAssay Description:The AlphaScreen Assay is modified to include the testing of inhibitors against ADAMTS-5 in the presence of 50% Lewis rat plasma in order to determine...More data for this Ligand-Target Pair
Affinity DataIC50: 897nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Affinity DataIC50: 704nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Affinity DataIC50: 1.53E+4nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Affinity DataIC50: >1.00E+5nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Affinity DataIC50: <5.10nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Affinity DataIC50: 439nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Affinity DataIC50: 26nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Affinity DataIC50: 4.19E+3nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
Affinity DataIC50: 7.99E+3nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
Eli Lilly
US Patent
Eli Lilly
US Patent
Affinity DataIC50: 2nMAssay Description:Inhibition of human ADAMTS4 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
Affinity DataIC50: 4.20E+3nMAssay Description:Inhibition of human MMP13 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
Affinity DataIC50: 8.00E+3nMAssay Description:Inhibition of human MMP14 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 20nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs in the presence of 50% Lewis rat plasm...More data for this Ligand-Target Pair
Affinity DataIC50: 3.00E+3nMAssay Description:Non competitive binding inhibition constant(Ki) of rat adenylate kinase (AK III) isozymes was determinedMore data for this Ligand-Target Pair
Affinity DataIC50: 26nMAssay Description:Competitive inhibition against rat cytoplasmic Thymidine kinaseMore data for this Ligand-Target Pair
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
Eli Lilly
Curated by ChEMBL
Eli Lilly
Curated by ChEMBL
Affinity DataIC50: 2nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair