BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLuxS
LigandBDBM64221
Substrate/Competitorn/a
Meas. Tech.Absorbance Microorganism-Based Dose Retest to Identify Inhibitors of Vibrio harveyi
EC50 13680±n/a nM
Citation PubChem, PC Absorbance Microorganism-Based Dose Retest to Identify Inhibitors of Vibrio harveyi PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
LuxS
Name:LuxS
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:15564.06
Organism:Vibrio harveyi
Description:B0LUE4
Residue:140
Sequence:
MPLLDSFTVDHTRMNAPAVRVAKTMQTPKGDTITVFDLRFTAPNKDILSEKGIHTLEHLY
AGFMRNHLNGDSVEIIDISPMGCRTGFYMSLIGTPSEQQVADAWIAAMEDVLKVENQNKI
PELNEYQCGTAAMHSLDEAK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM64221
NameBDBM64221
Synonyms:2-(2,5-diketo-4,4-diphenyl-imidazolidin-1-yl)-N-(3,5-dimethoxyphenyl)acetamide | 2-[2,5-bis(oxidanylidene)-4,4-diphenyl-imidazolidin-1-yl]-N-(3,5-dimethoxyphenyl)ethanamide | MLS001176525 | N-(3,5-dimethoxyphenyl)-2-(2,5-dioxo-4,4-diphenyl-1-imidazolidinyl)acetamide | N-(3,5-dimethoxyphenyl)-2-(2,5-dioxo-4,4-diphenylimidazolidin-1-yl)acetamide | SMR000592788 | cid_3918849
TypeSmall organic molecule
Emp. Form.C25H23N3O5
Mol. Mass.445.4672
SMILESCOc1cc(NC(=O)CN2C(=O)NC(C2=O)(c2ccccc2)c2ccccc2)cc(OC)c1
Structure
n/a