BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG-protein coupled receptor 55
LigandBDBM75871
Substrate/Competitorn/a
Meas. Tech.SAR Analysis of Selective Antagonists of GPR55 using an Image-Based Assay - Set 3
IC50>32000±n/a nM
Citation PubChem, PC SAR Analysis of Selective Antagonists of GPR55 using an Image-Based Assay - Set 3 PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
G-protein coupled receptor 55
Name:G-protein coupled receptor 55
Synonyms:G protein-coupled receptor 55
Type:PROTEIN
Mol. Mass.:36649.72
Organism:Homo sapiens (Human)
Description:ChEMBL_1292265
Residue:319
Sequence:
MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATS
IYMINLAVFDLLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRF
LAIRYPLLVSHLRSPRKIFGICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAK
VFFPLEVFGFLLPMGIMGFCCSRSIHILLGRRDHTQDWVQQKACIYSIAASLAVFVVSFL
PVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIR
AHRPSRVQLVLQDTTISRG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM75871
NameBDBM75871
Synonyms:1-[[(Z)-(3-phenylpyrazol-4-ylidene)methyl]amino]thiourea | MLS-0437448.0001 | [[(Z)-(3-phenyl-4-pyrazolylidene)methyl]amino]thiourea | [[(Z)-(3-phenylpyrazol-4-ylidene)methyl]amino]thiourea | cid_5335766
TypeSmall organic molecule
Emp. Form.C11H11N5S
Mol. Mass.245.304
SMILESNC(=S)NN=Cc1c[nH]nc1-c1ccccc1 |w:4.3|
Structure
n/a