Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target3-dehydroquinate dehydratase
LigandBDBM50170812
Substrate/Competitorn/a
Meas. Tech.ChEMBL_332877
Kd 30000±n/a nM
Citation Robinson, DAStewart, KAPrice, NCChalk, PACoggins, JRLapthorn, AJ Crystal structures of Helicobacter pylori type II dehydroquinase inhibitor complexes: new directions for inhibitor design. J Med Chem49:1282-90 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
3-dehydroquinate dehydratase
Name:3-dehydroquinate dehydratase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:16681.13
Organism:Streptomyces coelicolor
Description:ChEMBL_332877
Residue:157
Sequence:
MPRSLANAPIMILNGPNLNLLGQRQPEIYGSDTLADVEALCVKAAAAHGGTVDFRQSNHE
GELVDWIHEARLNHCGIVINPAAYSHTSVAILDALNTCDGLPVVEVHISNIHQREPFRHH
SYVSQRADGVVAGCGVQGYVFGVERIAALAGAGSARA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50170812
NameBDBM50170812
Synonyms:(1R,4R,5R)-1,4,5-Trihydroxy-cyclohex-2-enecarboxylic acid | 2,3 -ANHYDRO-QUINIC ACID | 2,3-anhydroquinic acid | CHEMBL190265
TypeSmall organic molecule
Emp. Form.C7H10O5
Mol. Mass.174.1513
SMILESO[C@@H]1C[C@@](O)(C=C[C@H]1O)C(O)=O |c:5|
Structure
n/a