Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetpoly(ADP-ribose) glycohydrolase (PARG)
LigandBDBM50106187
Substrate/Competitorn/a
Meas. Tech.ChEMBL_760969
IC50>1000000±n/a nM
Citation Steffen, JDCoyle, DLDamodaran, KBeroza, PJacobson, MK Discovery and structure-activity relationships of modified salicylanilides as cell permeable inhibitors of poly(ADP-ribose) glycohydrolase (PARG). J Med Chem54:5403-13 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
poly(ADP-ribose) glycohydrolase (PARG)
Name:poly(ADP-ribose) glycohydrolase (PARG)
Synonyms:Poly(ADP-ribose) glycohydrolase
Type:Protein
Mol. Mass.:111107.13
Organism:Homo sapiens (Human)
Description:Q86W56
Residue:976
Sequence:
MNAGPGCEPCTKRPRWGAATTSPAASDARSFPSRQRRVLDPKDAHVQFRVPPSSPACVPG
RAGQHRGSATSLVFKQKTITSWMDTKGIKTAESESLDSKENNNTRIESMMSSVQKDNFYQ
HNVEKLENVSQLSLDKSPTEKSTQYLNQHQTAAMCKWQNEGKHTEQLLESEPQTVTLVPE
QFSNANIDRSPQNDDHSDTDSEENRDNQQFLTTVKLANAKQTTEDEQAREAKSHQKCSKS
CDPGEDCASCQQDEIDVVPESPLSDVGSEDVGTGPKNDNKLTRQESCLGNSPPFEKESEP
ESPMDVDNSKNSCQDSEADEETSPGFDEQEDGSSSQTANKPSRFQARDADIEFRKRYSTK
GGEVRLHFQFEGGESRTGMNDLNAKLPGNISSLNVECRNSKQHGKKDSKITDHFMRLPKA
EDRRKEQWETKHQRTERKIPKYVPPHLSPDKKWLGTPIEEMRRMPRCGIRLPLLRPSANH
TVTIRVDLLRAGEVPKPFPTHYKDLWDNKHVKMPCSEQNLYPVEDENGERTAGSRWELIQ
TALLNKFTRPQNLKDAILKYNVAYSKKWDFTALIDFWDKVLEEAEAQHLYQSILPDMVKI
ALCLPNICTQPIPLLKQKMNHSITMSQEQIASLLANAFFCTFPRRNAKMKSEYSSYPDIN
FNRLFEGRSSRKPEKLKTLFCYFRRVTEKKPTGLVTFTRQSLEDFPEWERCEKPLTRLHV
TYEGTIEENGQGMLQVDFANRFVGGGVTSAGLVQEEIRFLINPELIISRLFTEVLDHNEC
LIITGTEQYSEYTGYAETYRWSRSHEDGSERDDWQRRCTEIVAIDALHFRRYLDQFVPEK
MRRELNKAYCGFLRPGVSSENLSAVATGNWGCGAFGGDARLKALIQILAAAAAERDVVYF
TFGDSELMRDIYSMHIFLTERKLTVGDVYKLLLRYYNEECRNCSTPGPDIKLYPFIYHAV
ESCAETADHSGQRTGT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50106187
NameBDBM50106187
Synonyms:Benzenecarboxamide | Benzoic acid amide | Benzoylamide | CHEMBL267373 | Phenylcarboxamide | Phenylcarboxyamide | benzamide
TypeSmall organic molecule
Emp. Form.C7H7NO
Mol. Mass.121.1366
SMILESNC(=O)c1ccccc1
Structure
n/a