Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlcohol sulfotransferase
LigandBDBM50051828
Substrate/Competitorn/a
Meas. Tech.ChEMBL_53128
IC50 80000±n/a nM
Citation Woo, LWPurohit, AReed, MJPotter, BV Active site directed inhibition of estrone sulfatase by nonsteroidal coumarin sulfamates. J Med Chem39:1349-51 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alcohol sulfotransferase
Name:Alcohol sulfotransferase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:33195.85
Organism:Rattus norvegicus
Description:ChEMBL_53128
Residue:284
Sequence:
MPDYTWFEGIPFHAFGISKETLQNVCNKFVVKEEDLILLAYPKSGTNWLIEIVCLIQTKG
DPKWIQSVTIWDRSPWIETDVGYDILIKKKGPRLMTSHLPMHLFSKSLFSSKAKVIYLIR
NPRDVLVSGYYFWGNSTLVKKPDSLGTYVEWFLKGNVLYGSWFEHIRAWLSMREWDNFLL
LYYEDMKKDTMGTIKKICDFLGKKLEPDELDLVLKYSSFQVMKENDMSNYSLLMKKSIFT
GIGLMRKGTIGDWKNHFTVSQAEAFDKVFQEKMAGFPPGMFPWE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50051828
NameBDBM50051828
Synonyms:2-(4-hydroxyphenyl)-3-methyl-1-(2,3,4,5,6-pentafluorobenzyl)-4-trifluoromethyl-1H-6-indolol, disulphate derivative(sulfate derivative of 2-phenylindole) | {3-methyl-1-[(2,3,4,5,6-pentafluorophenyl)methyl]-2-[4-(sulfonatooxy)phenyl]-4-(trifluoromethyl)-1H-indol-6-yl} sulfate
TypeSmall organic molecule
Emp. Form.C23H11F8NO8S2
Mol. Mass.645.454
SMILESCc1c(-c2ccc(OS([O-])(=O)=O)cc2)n(Cc2c(F)c(F)c(F)c(F)c2F)c2cc(OS([O-])(=O)=O)cc(c12)C(F)(F)F
Structure
n/a