Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRmtA
LigandBDBM50210461
Substrate/Competitorn/a
Meas. Tech.ChEMBL_434652
IC50 29900±n/a nM
Citation Spannhoff, AHeinke, RBauer, ITrojer, PMetzger, EGust, RSchüle, RBrosch, GSippl, WJung, M Target-based approach to inhibitors of histone arginine methyltransferases. J Med Chem50:2319-25 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
RmtA
Name:RmtA
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:39351.26
Organism:Emericella nidulans
Description:ChEMBL_475539
Residue:345
Sequence:
MSEIENSTITSSADRMVGMDHAEVRYFTSYDHHGIHEEMLKDDVRTRSYRDSIYQNRHIF
KDKVVLDVGCGTGILSMFAAKAGAKHVIGVDMSSIIEKAREIVAVNGLADKITLLQGKME
EVQLPFPSVDIIISEWMGYFLLYESMLDTVLYAQDRYLVPGGKIFPDKATMYLAGIEDGE
YKDDKIGFWDNVYGFDYSPMKEIALTEPLVDTVELKALVTDPCPIITFDLYTVTKEDLAF
EVPYSLPVKRSDFVHAVIAWFDIEFGACHKPINFSTGPHAKYTHWKQTVFYLRDVLTVEE
EESISGVLSNRPNDKNKRDLDINLTYKLETQDQTRFAEGGCFYRM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50210461
NameBDBM50210461
Synonyms:(stilbamidine)4-[2-[4-amino(imino)methylphenyl]-(E)-1-ethenyl]phenyl-iminomethanamine | 4,4'-(ethene-1,2-diyl)dibenzimidamide | 4-((E)-2-{4-[(Z)-amino(imino)methyl]phenyl}vinyl)benzenecarboximidamide | 4-((E)-2-{4-[(Z)-amino(imino)methyl]phenyl}vinyl)benzenecarboximidamide(stilbamidine isethionate) | CHEMBL142304 | NSC-35605 | stilbamidine
TypeSmall organic molecule
Emp. Form.C16H16N4
Mol. Mass.264.325
SMILESNC(=N)c1ccc(\C=C\c2ccc(cc2)C(N)=N)cc1
Structure
n/a