BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVma11p
LigandBDBM87566
Substrate/Competitorn/a
Meas. Tech.Dose Response of Small Molecules that Regulate V-ATPase Proton Transport in Yeast using pHLuorin, Cherry Pick 2
EC50 8904±n/a nM
Citation PubChem, PC Dose Response of Small Molecules that Regulate V-ATPase Proton Transport in Yeast using pHLuorin, Cherry Pick 2 PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article,  Assay Method
 
Vma11p
Name:Vma11p
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:17039.28
Organism:Saccharomyces cerevisiae S288c
Description:gi_6325022
Residue:164
Sequence:
MSTQLASNIYAPLYAPFFGFAGCAAAMVLSCLGAAIGTAKSGIGIAGIGTFKPELIMKSL
IPVVMSGILAIYGLVVAVLIAGNLSPTEDYTLFNGFMHLSCGLCVGFACLSSGYAIGMVG
DVGVRKYMHQPRLFVGIVLILIFSEVLGLYGMIVALILNTRGSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM87566
NameBDBM87566
Synonyms:MLS001234228 | SMR000811655 | [4-(4,6-difluoro-1,3-benzothiazol-2-yl)-1-piperazinyl]-(5-nitro-2-furanyl)methanone | [4-(4,6-difluoro-1,3-benzothiazol-2-yl)piperazin-1-yl]-(5-nitrofuran-2-yl)methanone | [4-(4,6-difluoro-1,3-benzothiazol-2-yl)piperazino]-(5-nitro-2-furyl)methanone | [4-[4,6-bis(fluoranyl)-1,3-benzothiazol-2-yl]piperazin-1-yl]-(5-nitrofuran-2-yl)methanone | cid_7539642
TypeSmall organic molecule
Emp. Form.C16H12F2N4O4S
Mol. Mass.394.353
SMILES[O-][N+](=O)c1ccc(o1)C(=O)N1CCN(CC1)c1nc2c(F)cc(F)cc2s1
Structure
n/a