BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaspase-9
LigandBDBM89226
Substrate/Competitorn/a
Meas. Tech.SAR analysis of small molecule inhibitors of Apaf-1 using a LZ-Caspase-9/Caspase-3 Fluorescent Selectivity assay - Set 2
IC50 20100±n/a nM
Citation PubChem, PC SAR analysis of small molecule inhibitors of Apaf-1 using a LZ-Caspase-9/Caspase-3 Fluorescent Selectivity assay - Set 2 PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article,  Assay Method
 
Caspase-9
Name:Apoptotic protease-activating factor 1/Caspase-3/Caspase-9/Cytochrome c
Synonyms:Apoptotic protease-activating factor 3 | CASP-9 | Caspase 9 | ICE-like apoptotic protease 6 | caspase-9 isoform alpha preproprotein
Type:Enzyme
Mol. Mass.:46277.29
Organism:Homo sapiens (Human)
Description:n/a
Residue:416
Sequence:
MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLII
DLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSKPTLENLTPVVLRPEIRKPEV
LRPETPRPVDIGSGGFGDVGALESLRGNADLAYILSMEPCGHCLIINNVNFCRESGLRTR
TGSNIDCEKLRRRFSSLHFMVEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQ
ASHLQFPGAVYGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVAS
TSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPGFVSWRDPKSG
SWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQMPGCFNFLRKKLFFKTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM89226
NameBDBM89226
Synonyms:1-(3,4-dichlorobenzyl)-4,6-dimethyl-isatin | 1-[(3,4-dichlorophenyl)methyl]-4,6-dimethyl-indole-2,3-dione | 1-[(3,4-dichlorophenyl)methyl]-4,6-dimethylindole-2,3-dione | MLS-0469603.0001 | cid_53389328
TypeSmall organic molecule
Emp. Form.C17H13Cl2NO2
Mol. Mass.334.197
SMILESCc1cc2N(Cc3ccc(Cl)c(Cl)c3)C(=O)C(=O)c2c(C)c1
Structure
n/a