BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHigh-affinity choline transporter
LigandBDBM95194
Substrate/Competitorn/a
IC50 3850±n/a nM
Citation PubChem, PC Dose responses of compounds that inhibit the Choline Transporter (CHT) in a 3H-choline uptake radioactive assay PubChem Bioassay(2012)[AID]
More Info.:Get all data from this article
 
High-affinity choline transporter
Name:High-affinity choline transporter
Synonyms:high affinity choline transporter 1
Type:PROTEIN
Mol. Mass.:63194.33
Organism:Homo sapiens (Human)
Description:ChEMBL_1464247
Residue:580
Sequence:
MAFHVEGLIAIIVFYLLILLVGIWAAWRTKNSGSAEERSEAIIVGGRDIGLLVGGFTMTA
TWVGGGYINGTAEAVYVPGYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQ
IYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDMHISVIISALIATLYTLVGG
LYSVAYTDVVQLFCIFVGLWISVPFALSHPAVADIGFTAVHAKYQKPWLGTVDSSEVYSW
LDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMAIPAILIGAIGASTDW
NQTAYGLPDPKTTEEADMILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFA
RNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIVIFPQ
LLCVLFVKGTNTYGAVAGYVSGLFLRITGGEPYLYLQPLIFYPGYYPDDNGIYNQKFPFK
TLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLD
ELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM95194
NameBDBM95194
Synonyms:2-chloranyl-4-nitro-N-[4-(pyridin-2-ylsulfamoyl)phenyl]benzamide;2,2,2-tris(fluoranyl)ethanoic acid | 2-chloro-4-nitro-N-[4-(2-pyridinylsulfamoyl)phenyl]benzamide;2,2,2-trifluoroacetic acid | 2-chloro-4-nitro-N-[4-(2-pyridylsulfamoyl)phenyl]benzamide;2,2,2-trifluoroacetic acid | 2-chloro-4-nitro-N-[4-(pyridin-2-ylsulfamoyl)phenyl]benzamide;2,2,2-trifluoroacetic acid | VU0464767-1 | cid_54759172
TypeSmall organic molecule
Emp. Form.C18H13ClN4O5S
Mol. Mass.432.838
SMILES[O-][N+](=O)c1ccc(C(=O)Nc2ccc(cc2)S(=O)(=O)Nc2ccccn2)c(Cl)c1
Structure
n/a