BDBM239953 US9403801, 12
SMILES Cn1cc(Nc2ncc(Cl)c(NC3CC4CN(CC4C3)C(=O)CC#N)n2)cn1
InChI Key InChIKey=LATBTOTUGAOJBF-UHFFFAOYSA-N
Data 4 IC50
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 4 hits for monomerid = 239953
Affinity DataIC50: 1nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 7nMpH: 7.0 T: 2°CAssay Description:TYK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx...More data for this Ligand-Target Pair
Affinity DataIC50: 18nMpH: 7.0 T: 2°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
Affinity DataIC50: 359nMpH: 7.0 T: 2°CAssay Description:JAK3 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx....More data for this Ligand-Target Pair
