BDBM239955 US9403801, 14A::US9403801, 14B

SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4(CCN(C4)C(=O)CC#N)CC3)n2)cn1

InChI Key InChIKey=OYVOATNFWDYRPN-UHFFFAOYSA-N

Data  6 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 6 hits for monomerid = 239955   

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239955(US9403801, 14A | US9403801, 14B)
Affinity DataIC50:  0.800nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239955(US9403801, 14A | US9403801, 14B)
Affinity DataIC50:  2nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239955(US9403801, 14A | US9403801, 14B)
Affinity DataIC50:  1nMpH: 7.0 T: 25°CAssay Description:TYK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent

TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239955(US9403801, 14A | US9403801, 14B)
Affinity DataIC50:  15nMpH: 7.0 T: 25°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent

TargetTyrosine-protein kinase JAK3(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239955(US9403801, 14A | US9403801, 14B)
Affinity DataIC50:  39nMpH: 7.0 T: 25°CAssay Description:JAK3 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx....More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent

TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239955(US9403801, 14A | US9403801, 14B)
Affinity DataIC50:  5nMpH: 7.0 T: 25°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent