BDBM239962 US9403801, 27
SMILES Cn1cc(Nc2ncc(Cl)c(NC3CCC4(CC3)CCN(CC4)c3ccc(cn3)C#N)n2)cn1
InChI Key InChIKey=ZOCZBCQGMSYPSI-UHFFFAOYSA-N
Data 2 IC50
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 2 hits for monomerid = 239962
Affinity DataIC50: 4nMpH: 7.5 T: 2°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 23nMpH: 7.0 T: 2°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
